KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0088Help
Entry
LDBND_0088        CDS       T01360                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00010  Glycolysis / Gluconeogenesis
lde00052  Galactose metabolism
lde00500  Starch and sucrose metabolism
lde00520  Amino sugar and nucleotide sugar metabolism
lde00521  Streptomycin biosynthesis
lde01100  Metabolic pathways
lde01110  Biosynthesis of secondary metabolites
lde01120  Microbial metabolism in diverse environments
lde01130  Biosynthesis of antibiotics
lde01200  Carbon metabolism
Module
lde_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lde_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBND_0088
   00052 Galactose metabolism
    LDBND_0088
   00500 Starch and sucrose metabolism
    LDBND_0088
   00520 Amino sugar and nucleotide sugar metabolism
    LDBND_0088
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LDBND_0088
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LDBND_0088
Enzymes [BR:lde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LDBND_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N Kelch_1
Motif
Other DBs
NCBI-ProteinID: ADQ60142
UniProt: E4SV29
Position
89766..90704
Genome map
AA seq 312 aa AA seqDB search
MKKYAFGVDIGGTTVKIGLFETNGELSQKWEIPTRKEGNGAKILPDIAASLNDKLKELDI
PKEEVAGVGIDVPGPILDDEIVNRCVNLGWGVFNVAEKVRKLTGLDEVKVANDANAAALG
EMWQGGGESHQNVVMVTLGTGVGGGIISEGKIVAGAFGASGEIGHMLVNKDETQLCGCGK
KGHLEQYASATGIARKAKELLVESSEESSLRGVDQLDAKAVFDAAKEGDKLALEIVDFVG
ETLGTALASISCVFDPEVYVIGGGVSKAGQILLDTVQKHFVDAAFHASEGTEFALAQLGN
DAGMYGAVKMVL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaatatgcatttggtgttgacatcggtggtaccactgtaaagattggtttgttt
gaaaccaacggtgaattgtcccaaaagtgggaaatcccaaccagaaaagaaggcaacggg
gctaagatcctgcctgacatcgcagcttctctgaacgacaagctgaaggaactggacatt
cctaaggaagaagtagccggggtcggcatcgacgtgccaggtccaatcctggacgacgaa
atcgtcaaccgctgcgtcaacctgggctggggcgtcttcaacgtggctgaaaaggtccgc
aagctgactggcctggacgaagtcaaggtagccaatgacgccaacgctgctgctttgggt
gaaatgtggcaaggtggtggtgaaagccaccaaaacgttgtcatggttaccctgggtacc
ggtgtcggcggcgggatcatctctgaaggcaagatcgtcgctggtgcctttggggcttcc
ggggaaatcggccacatgctggtcaacaaggatgaaacccagctctgcggctgcggcaag
aagggccacctggaacaatacgcttccgctactggcattgcccgcaaggccaaggaactt
ctggttgaaagcagcgaagaatcaagtctgcgcggggtagaccagcttgacgccaaggcc
gtctttgacgcggctaaggaaggcgacaagctggctttggaaatcgtggactttgtcggc
gaaactttgggcactgccctggcttccatctcctgcgtctttgacccagaagtctacgtt
atcggcggcggggtctccaaggctggccaaatcttgctcgacactgtgcaaaagcacttc
gttgacgcggccttccacgcttctgaaggtactgaattcgccctggcccaactgggcaac
gatgccggtatgtacggtgccgttaagatggttctgtaa

DBGET integrated database retrieval system