KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0220Help
Entry
LDBND_0220        CDS       T01360                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde00010  Glycolysis / Gluconeogenesis
lde00260  Glycine, serine and threonine metabolism
lde00680  Methane metabolism
lde01100  Metabolic pathways
lde01110  Biosynthesis of secondary metabolites
lde01120  Microbial metabolism in diverse environments
lde01130  Biosynthesis of antibiotics
lde01200  Carbon metabolism
lde01230  Biosynthesis of amino acids
Module
lde_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBND_0220
  Energy metabolism
   00680 Methane metabolism
    LDBND_0220
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LDBND_0220
Enzymes [BR:lde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LDBND_0220
Membrane trafficking [BR:lde04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LDBND_0220
Exosome [BR:lde04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LDBND_0220
  Exosomal proteins of melanoma cells
   LDBND_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ADQ60273
Position
225918..226607
Genome map
AA seq 229 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSDKGVEEAKKAGRLIKEAGLEFDQAYTSVLTR
AIKTLHFALEESGQLWVPETKSWRLNERHYGALQGLNKAETAEKYGDEQVHIWRRSYDVL
PPVLADDSEFSQANDRRYANLDPHIVPKAENLKVTLDRVMPFWEDHIAPDLLAGKNVIIA
AHGNSLRALTKYIENISDEDIMDVEMKTGEPVVYTFDDKLNVVSKEKLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattagttttaatccgtcacggtcaaagtgaatggaacctttcaaaccaattc
actggttgggttgacgttaacttgtcagacaagggtgttgaagaagctaagaaggctggt
cgtttgatcaaggaagccggcttggaatttgatcaagcttacacttcagttttgacccgt
gcgatcaagactttgcactttgccttggaagaaagcggccaactctgggttccagaaact
aagtcctggagactgaacgaacgtcactacggcgctttgcaaggcttgaacaaggctgaa
actgctgaaaagtacggcgacgaacaagttcacatttggcgtcgttcatacgacgttttg
ccaccagttttggctgacgactcagaattcagccaagctaacgaccgtcgttacgcaaac
ttggacccacacatcgttcctaaggcagaaaacctgaaggttactctggacagagttatg
ccattctgggaagaccacattgctccagaccttttggctggcaagaacgtgatcatcgct
gctcatggtaactcactgcgtgccttgactaagtacatcgaaaacatctctgacgaagac
atcatggatgttgaaatgaagactggtgaaccagtcgtttacactttcgacgacaagttg
aacgttgtaagcaaggaaaagctggactaa

DBGET integrated database retrieval system