KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0262Help
Entry
LDBND_0262        CDS       T01360                                 

Definition
phospho-beta-galactosidase ii
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBND_0262
Enzymes [BR:lde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LDBND_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
273607..275079
Genome map
AA seq 490 aa AA seqDB search
MAHFRKDFLWGGAVAANQVEGGYNEGGKGLSVTDITTAGSLESPRYLTYTLDGKDGKVAG
MFASSLPKGAKGKIFDNEYYPNHVAIDFYHHYKEDIKMFADMGFKVFRTSIAWTRIFPTG
EEDKPNQEGLDFYRRVFEELKKNGIEPLVTISHYEDPLALGEKYNDWQDRKMIDLYVKYA
TTLFKEYKDLVKYWLTFNEINSSLMFLKLVGDGKVSDADYQKAYQKLHHQFVASAKAVVA
GHKINPDFMIGNMIAGSVYYPGTPDPKDALAARYEEELSQLYCADAQAKGEYPSFAKRLW
DEHNVHLKIEDGDLEVMKEGKVDMYTFSYYMSNMVTTHDVGEKAKGNFAAGAKNPYLEYS
EWGWSTDPDGLQLYLEKMYDRYGIPMMVVENGLGAVDKLEDGTVHDDYRIDYLRKHIKAM
DKAVEHGVDLRAYTTWGCIDCVSAGTGQMSKRYGFIYVDRDDKGEGTLKRLPKDSYYWYQ
KVIASNGDEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctcattttagaaaagactttttgtggggcggcgccgtagctgctaaccaagttgaa
ggtggatacaacgaaggcggcaagggcttgtcagtgactgacattaccacggccggctct
ttggaaagtccgcgttatctgacttacactttggatggcaaggatggcaaagtagctggg
atgttcgccagctccttgccaaagggcgctaaggggaagatttttgacaatgaatactac
ccgaaccatgtagcgatcgatttttaccatcattacaaggaagacatcaagatgttcgcg
gacatgggctttaaggtattcagaacttccattgcctggacgcggattttcccaaccggt
gaagaagacaagccaaaccaggaagggctggacttctaccgcagagtctttgaagaactg
aagaagaacgggattgaaccattagttacgatttcccactatgaagacccattggcttta
ggcgaaaagtacaacgactggcaagaccgcaagatgattgacctctacgttaagtacgcg
acgaccttgttcaaggaatacaaggacctggttaaatactggctgaccttcaacgaaatc
aactcatccttgatgttcttgaagctggtgggtgatggcaaggtatctgatgcagattac
caaaaggcttaccaaaagctgcaccaccaattcgttgcttctgctaaggcagttgttgca
ggccacaagatcaacccagacttcatgatcgggaacatgattgccggttctgtttactac
ccaggcacccctgatccaaaggatgctttggctgctcgctatgaagaagaattgagccag
ctttactgtgctgacgcgcaagctaagggtgagtatccaagttttgccaagcgcttatgg
gatgaacacaatgttcatttgaagattgaagatggcgaccttgaagtcatgaaggaaggt
aaagttgacatgtacaccttctcatactacatgtcaaacatggttaccacccatgatgtt
ggcgaaaaggctaagggcaacttcgctgccggcgctaagaacccatatcttgaatactct
gaatggggctggtcaactgacccagacggcttgcaactgtacttggaaaagatgtatgac
cgttatggcatcccaatgatggtggtggaaaatggtcttggtgccgttgataagctagaa
gatggtactgttcatgacgattaccggattgactacttgagaaagcacatcaaggcgatg
gacaaggcagttgaacatggggttgacctgcgtgcctacacgacttggggctgcattgac
tgcgtttctgccggaactggtcaaatgtccaagcggtatggcttcatctacgttgaccgt
gatgacaagggcgaaggtacgcttaagcgcctgcctaaggattcatactactggtaccaa
aaggttatcgcttcaaacggcgatgaattataa

DBGET integrated database retrieval system