KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0303Help
Entry
LDBND_0303        CDS       T01360                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LDBND_0303
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LDBND_0303
Enzymes [BR:lde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LDBND_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
312394..313665
Genome map
AA seq 423 aa AA seqDB search
MKQMIIHGGKPLQGDIWIGGAKNSTVALIPASILSRTPVTLESVPRIADVDNLMDLLSEM
YVHCDFRETTLQIDPTEIKMSPLPAGKIKSLRASYYFMGALLGRFGKAVVGFPGGDDIGP
RPIDQHIMGFQSLGADVRYENEQIVITAPDEGLKGAQIHLKMASVGATMNIIMASVTASG
RTVIENAAKEPEIIDLATFLNNMGAKIRGAGTDTIRIDGVDRLEAKVPHTIIPDRIEAGT
YISMAACIGNGIRIHNIISEHLDAFLAKVEEMGVVIDTDEDSLFVYPAGDLRMVQVKTGT
YPGFATDLQQPITPLLLTAKTGEGVIIDPIYPKRTRHVPELQKMGASITVVNNIILVQPG
SRLRGAVVHADEIRAGACLMLTGLMVDGETVINNAGNILRGYDRVEEKLRQLGADVVIRD
VED
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaatgataattcacggagggaaacccctgcaaggcgacatctggattggcggc
gcgaagaactcaacggtagcgctgattccggcctcaatcctgtcgagaacgccggtgacc
ctggaatcagttccgcggattgccgacgttgacaatttgatggacttgttgagcgaaatg
tacgtgcactgcgacttccgcgaaacgaccctgcaaattgacccgactgaaatcaagatg
agtcccctgccagctgggaagattaagagcttgcgcgcgtcttactactttatgggcgct
ttgctcggtcgttttggcaaggcggttgtagggtttcctggtggtgatgacattggcccg
cggccgattgaccagcacattatgggcttccaatccctcggcgccgacgttagatatgaa
aatgagcagattgtaattaccgcgcctgatgaagggttgaaaggggcccagattcacctg
aagatggcttctgttggggcaacgatgaacatcatcatggcctcagtcacggccagcggc
cggacggtgatcgaaaacgcggccaaggagccggaaatcatcgacctggcaactttcttg
aacaacatgggggccaagatccgcggggcggggactgacaccatcagaatcgacggggtt
gaccgcctggaggccaaggtgccgcacacgatcatccctgatcggattgaagccgggact
tacatttccatggcagcctgcatcggtaacgggatccggatccacaacatcatctctgaa
caccttgacgcctttttggccaaggtggaagaaatgggcgtggtgatcgacactgatgaa
gactccctcttcgtttacccggccggggacctgcgcatggtccaggtcaagaccgggacc
tacccgggcttcgcgactgacttgcagcagccaattacgccgctcttgctgacggctaag
accggggaaggggtcatcatcgacccgatctacccgaagcggacccggcacgtgccggaa
ctgcagaagatgggggcttccatcacggtcgttaacaacatcattctggttcaaccgggc
agccgcctgcgcggggcggtggttcacgctgacgaaatccgggccggggcctgcttgatg
cttacgggcttgatggttgacggcgaaacggtgatcaacaatgctggcaacatcttgcgc
ggctatgaccgggtggaagaaaagctgcgccagctgggcgctgacgtggtcatccgggac
gtggaagattaa

DBGET integrated database retrieval system