KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0499Help
Entry
LDBND_0499        CDS       T01360                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LDBND_0499
   00052 Galactose metabolism
    LDBND_0499
   00500 Starch and sucrose metabolism
    LDBND_0499
   00520 Amino sugar and nucleotide sugar metabolism
    LDBND_0499
Enzymes [BR:lde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LDBND_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
509433..510347
Genome map
AA seq 304 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAMASGIEDILIVTGKSK
RAIEDHFDSNPELEDNLTEKHKDALLKLVRETTMSNTKVNLYFTRQPHPNGLGDAVNRAR
SFIAGEPFVVMLGDDLMRDKTPLTKQLIDCYDETHASTIAVMKVPHEEVNKYGVIDPIGE
TAPDLYNVKAFVEKPDIDKAPSDLAIIGRYLLTPEIFDMLDKQKAGAGGEIQLTDAIDAL
NKTQRVFAHEFKGQRFDVGNKEGYVETSIQYGLRHPETKDALRKYIIDLGKRLESEGKKK
PAGK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagaaaagcgatcatcccagctgccggtttgggaaccagatttttgccagca
accaaggccatgcctaaggaaatgctgccaatcgttgacaagccaactattcaatttatc
gttgaagaagccatggcttcagggattgaagacattctgatcgttactggcaaaagcaag
cgggcaatcgaagaccacttcgactcaaacccggaactggaagacaacctgactgaaaag
cacaaggacgcgcttttgaagctggtccgggaaaccaccatgtctaacacgaaggttaac
ctttactttacccggcagccgcatccaaatggcttgggggatgccgtcaaccgggctcgc
agcttcatcgccggtgaacctttcgtggttatgctaggcgacgacttgatgagagacaag
acgccattgaccaagcaattgatcgactgctacgatgaaactcacgcttcaaccatcgcg
gttatgaaggtgccgcatgaagaagttaacaagtacggtgtcatcgacccaatcggcgaa
actgctccggacctgtacaacgttaaggcttttgtggaaaagccagacattgacaaggcc
ccaagtgacctggctatcatcggccgctacctgctgactccggaaatttttgacatgctg
gacaagcaaaaggccggtgccggcggcgaaatccaattgactgacgccatcgacgccctg
aacaagacccaacgggtcttcgcccatgaattcaagggccagcgttttgacgtcggcaac
aaggaaggctacgtggaaacttccatccaatacggtcttcgtcacccggaaaccaaggat
gctttgcgcaagtacatcattgacttgggcaagcggctggaaagcgaaggcaagaagaag
ccagccggcaagtaa

DBGET integrated database retrieval system