KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0693Help
Entry
LDBND_0693        CDS       T01360                                 

Definition
ATP-dependent DNA helicase, recd/traa family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LDBND_0693
Enzymes [BR:lde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LDBND_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
692547..694937
Genome map
AA seq 796 aa AA seqDB search
MTEFSGEVKSVIYENAQNMYKILLVAVSQPLAGYDDDEIKVMGTFGDLELGQEYNFSGDL
VTHPKYGLQFQATGCQPALPKETGGVVKYLSSDKFPGIGPKTAEKIVDQLGSGGLKSLQA
DPALIAKLDLSQKQKDSLLSGLAQMDSFDDLAMTLSSYGIPRKVAGRLYQKYHDQTLKKL
QADPYLPLGEVTGYSFKQADHLGTGFGIALDSLERADGSILAVLLQALTMEGETYLELEE
LLPAAKELTNINFDRLAEAVNDLQDKKKVVVEKGRASLLAPFQVESEIVTDLEDLLAKGK
EADYREKDLDQAIKRAERKLGISYDPEQKQAIKNAVTSPVSILTGGPGSGKTTIIDGILL
VLKDLVDMDEEEAEEAILLAAPTGRAAKRMGEVTGYPAKTIHRLLGLGIDNSEEMELNDL
EGEILIVDEMSMVDIYLFEKLLSAISNVHHLVFVGDKDQLPSVGAGKVFADLIEADFIPT
CQLQVVHRQKDDSTIIPLAHAVNEGANPAVLLQKTASYSFIPCRPHAVPSVVEQITQAAL
KSGFAADDIQVLGAMYRGDGGINSLNDTLQRVINPEKGNDKAVEAHGENFRLHDRVLQLQ
NDPERGIYNGEIGKVVAVDPEMLEDEDDEVKLLVNFDGKEVAYTQADLNNLTRAYAITIH
KSQGSEFPLVILCLTMQNYIMLKRNLLYTAITRASQKLVMVGEEQAFAQAMRVKGNERRT
NLVWLLKDRFKPEEQSKQESSDSTENTLDKEEKAEDYILTGARISRAEISPMVGMEDLVQ
GCKNLAEIVRTKGPGA
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtttagcggtgaagtaaagagcgttatttatgaaaacgcgcaaaacatgtac
aagatcttgctggtcgccgtaagtcagcctctggccggctatgacgatgatgaaatcaag
gtgatggggaccttcggggacctggagcttggccaggaatacaactttagcggtgacttg
gtcacccaccccaagtacggcttgcagtttcaagcgactggctgccagccggccctgccg
aaagagactggcggggtggtcaagtacctgtcttctgacaagttccctggcatcgggccc
aagacggcggaaaaaatcgttgaccagctgggcagcggaggcttaaagagcttgcaggct
gatccagccttgatcgccaagctggatctttcccaaaagcaaaaagacagcctcttgtcc
ggcctggcccagatggattcctttgacgacctggctatgactttgtccagttacgggatt
ccccgcaaggtggccggccgcctttaccagaagtaccatgaccagaccttgaaaaagctg
caggccgatccctacctgcctttaggcgaagtgaccggctattccttcaagcaggccgac
cacttgggaactggctttggaattgcccttgacagtctggagcgggctgatggcagtatc
ctggcggttttgctccaggccttgaccatggagggggaaacctacctggaactggaagaa
cttttgccagccgccaaggaactgacaaatataaattttgaccgcctggcagaagcagtt
aacgacctgcaggacaagaagaaggtcgtcgtggaaaaaggccgggccagcctgctggcc
ccatttcaagtggaaagcgagatcgtgaccgacctggaagaccttttagccaagggcaag
gaagcggactaccgggaaaaggacttggaccaggccatcaagcgggccgaaaggaagctg
gggatcagctatgaccctgagcaaaagcaggccatcaaaaacgcggtaaccagtccggtc
tccatcctgactgggggacccgggagcgggaagacgaccatcattgacgggatcttgctg
gtcttaaaggacctggtcgacatggacgaagaagaagctgaagaagcgattctcctggcc
gcgccaaccggccgggcagccaagcggatgggggaagtcaccggctatccggccaagacc
atccaccgcctcttgggcctggggatcgacaacagcgaggaaatggagctgaatgatttg
gaaggggagatcttgatcgtcgacgaaatgtccatggtcgacatctacctctttgaaaag
ctgctcagcgccatcagcaatgttcaccacctggtctttgtcggtgacaaggaccaattg
ccatccgtcggggcggggaaggttttcgctgacttgatcgaggcggacttcattccgacc
tgccagttgcaggtggtccaccggcaaaaggacgattcaacgatcattcccctggcccac
gcggtcaacgaaggagccaacccggctgttctcttgcaaaagacggccagctactccttt
attccttgccggccccatgccgtgcctagcgtcgtcgagcagatcacccaggcagcctta
aagagtggctttgcggctgacgacatccaggttctgggggccatgtaccggggcgacggg
gggatcaacagtttgaatgacacccttcagcgggtgatcaacccggaaaagggcaatgat
aaagcagttgaggcccatggtgagaacttccgcctgcatgaccgggtcctgcagctgcaa
aatgacccggagcgggggatctacaacggcgagattggaaaggtcgtggccgttgacccg
gaaatgctggaagacgaggatgacgaagtcaagcttttggtcaattttgacggcaaagaa
gtggcttacacgcaggcagacttgaataacctgacccgggcttatgccatcaccatccac
aagtcccaggggtcagaatttcctttggtcattctctgcttaaccatgcagaactatatc
atgctcaagcgcaatcttttgtatacggccatcacccgggcttcccagaagctggtcatg
gtcggagaagagcaggcttttgcccaggccatgcgggtcaagggcaatgagcggcggacc
aacctggtttggctcttgaaggaccgctttaagccagaagaacaaagtaagcaagagagt
agtgactctacagagaatactctggataaagaagaaaaagccgaagactacatcttgacc
ggggcccggatcagccgggcggagatttcccccatggtcggcatggaggacctggttcag
ggatgcaagaatctggcggaaatcgtccggaccaagggtccaggagcctaa

DBGET integrated database retrieval system