KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0760Help
Entry
LDBND_0760        CDS       T01360                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LDBND_0760
   01230 Biosynthesis of amino acids
    LDBND_0760
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBND_0760
   00030 Pentose phosphate pathway
    LDBND_0760
   00051 Fructose and mannose metabolism
    LDBND_0760
   00052 Galactose metabolism
    LDBND_0760
  Energy metabolism
   00680 Methane metabolism
    LDBND_0760
Enzymes [BR:lde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LDBND_0760
Protein phosphatases and associated proteins [BR:lde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LDBND_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
773472..774431
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVTRVAIANGLEVFGIRYGFAGLVAGDIFPLESEDVAHL
INVSGTFLYSARYPEFAEEEGQLAGIEQLKKHGIDAVVVIGGDGSYHGALQLTRHGFNSI
GLPGTIDNDIPYTDATIGYDTACMTAMDAIDKIRDTASSHHRVFIVNVMGRNCGDIAMRV
GVACGADAIVIPERPYDVEEIANRLKQAQESGKDHGVVVVAEGVMTADQFMAELKKHGDF
DVRANVLGHMQRGGTPTVSDRVLASKLGSEAVHLLLEGKGGLAVGIENGKVTSHDILDLF
DESHKGDYDLLKLNADLSR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttgactagcggcggtgacgcccctggtatgaatgcagccgta
agagccgtaaccagagtcgcgatcgcgaacggtttggaagttttcggtatcagatacggt
tttgcaggtttggttgcgggcgacattttcccattggaaagtgaagacgtagcccacttg
atcaatgtttccggtaccttcctctactctgcgcgttatcctgaatttgcagaagaagaa
ggacagctggctggtattgaacaattgaagaagcacggcatcgatgctgttgtcgttatt
ggtggggatggttcctaccatggcgccctgcagctgacccgccacggcttcaactcaatt
ggcctgccaggcacgatcgacaacgacatcccttacacggatgccacgatcggctatgac
acggcctgcatgacggcaatggacgcgatcgacaagatccgtgacactgcttccagccac
caccgggtcttcatcgtcaacgtaatgggccgcaactgtggtgacatcgctatgcgcgtc
ggcgtagcctgcggggcggacgcgatcgtcattcctgaaagaccatatgatgtcgaagaa
atcgccaaccggctcaagcaagcccaggaaagcggtaaggaccacggtgtggtagtcgtt
gctgaaggcgtaatgaccgctgaccaattcatggctgaactgaagaagcatggtgacttc
gacgtccgggccaatgttttgggtcacatgcagcggggcggcacgccaactgtttctgac
cgggtgctggcttccaagctgggcagcgaggccgttcaccttcttttggaaggcaagggc
ggcctggctgtcggcattgaaaacggcaaggttacttcacacgacatccttgatttattt
gatgagtctcacaagggtgactatgacttgttaaagctcaacgcagatttatcaagatag

DBGET integrated database retrieval system