KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0837Help
Entry
LDBND_0837        CDS       T01360                                 

Definition
alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LDBND_0837
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBND_0837
   00620 Pyruvate metabolism
    LDBND_0837
   00650 Butanoate metabolism
    LDBND_0837
  Lipid metabolism
   00071 Fatty acid degradation
    LDBND_0837
  Amino acid metabolism
   00350 Tyrosine metabolism
    LDBND_0837
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LDBND_0837
   00626 Naphthalene degradation
    LDBND_0837
Enzymes [BR:lde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LDBND_0837
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LDBND_0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(855112..857886)
Genome map
AA seq 924 aa AA seqDB search
MLGEKVHNKYLDLIKNVVIFRREKMVDVKKTQTTATAAKELSADEKMEEAKRYTGELVNK
ALVAEETYATYSQEQVDKIVAAMALAGSEASLALAHEAVDETGRGVVEDKDTKNRFATEN
VYNSIKHEKTVGIIERNQVEGYIKVAAPLGVLAGIVPTTNPTSTTMFKILVALKTRNAII
FSFHPKAQKCSIHAAQILYDAALKAGAPKNIIQWIDKASLENTTALIRNPKIASILATGG
PGMVHAALQSGNPSMGVGAGNGAVYIDHTAFLDRAVEDTLLSKRFDNSMVCATENSAVVE
APIYDKWLQMMQDKGAYLVPKKDYQKLADFVFNDKHGVNGPVAGMSARWICEHAGVTLPE
GKDVLLFELDPKNIGEKLSSEKLSPILSVYKAKDREDGIRIVKALLDYQGAGHNAAIQIG
SQNDPFIDEYGKAVQASRVLVNQPDALGGIGDIYSDGLRPSLTLGTGSWGKNSLSHNLST
SDLLNIKTIAKRRNRPQWIRLPEKIFYEKDSITYLSDENEQEISRAFIVADPGMVKFHFV
DKVYEQLALRDKQVDTAIYSEVLPDPPLSQAIKIAKQMKKFAPDTIIAIGGGSALDVSKI
ARYIYEYSLDQEDGWLDNYDNVSELFKELQQKFVDIRKRIVKFKHETRTSLVCIPTTSGT
GSEVTPYAVITDDKQHVKYPLTDYELTPQVAIVDPAFVMTVPKHTVAFSGFDCLSHSLES
YVSVAASDFTRPWSLKAIQLIMNNLEASYKYDPQHPTYEGEKARENMHYAATLAGMAFAN
AFLGLNHSIAHKLGGAFGFPHGLCISIAMLPVIKFNGASGNVKRTPYPRYEVYRAQKDYA
DIARSLGLPGKSDAELVDSLCKRIRELMKACDIEPSLSANGVSKEAFDAALPAMIDRVYD
DQCTVQNPRQPSMAEIKQLLLSMY
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgttaggtgaaaaggttcacaataaatacttagacctgataaaaaatgtagtaattttt
aggagagaaaaaatggttgatgtaaagaaaacacagaccactgctactgctgccaaggaa
ttgtcagctgatgaaaagatggaagaagccaagcgctatacaggtgaattagttaacaaa
gccttggtcgctgaagaaacctacgcgacctacagccaggaacaagttgacaagattgtc
gctgccatggctttggccggcagtgaggcctccctcgcgcttgctcatgaggcagtagac
gaaactggccgcggcgtggtagaagacaaggataccaagaaccgcttcgctaccgaaaat
gtctacaactcaattaagcacgaaaagactgttggcattatcgaaagaaaccaggttgaa
ggctatatcaaagttgctgctcctcttggcgttttagccgggatcgtgccaaccaccaac
ccgacctcaacgaccatgttcaagatcctggtagctttgaagaccagaaacgccatcatc
ttctccttccacccgaaggcccagaagtgttcaatccatgctgcccagatcttgtatgac
gctgctttaaaggccggtgccccaaagaacatcattcaatggatcgacaaggccagcctg
gaaaacaccaccgccttgatccgcaacccaaagatcgcttctattttggcaactggtggt
cccggcatggtgcatgccgcgctgcagtctggcaacccgtcaatgggggtcggggccggc
aacggtgctgtttacatcgaccacaccgcctttttggaccgggctgttgaagataccctt
ttgtccaagcgctttgacaacagcatggtttgcgcgactgaaaactcagccgtagttgaa
gcaccgatctacgacaagtggctgcaaatgatgcaggacaagggtgcctacctggttcca
aagaaagactaccaaaagctggccgacttcgtcttcaatgacaagcatggggtcaatggg
ccagtagccgggatgagcgcccgctggatttgtgaacacgccggcgttaccctgcctgaa
ggcaaggatgtcctcctctttgaactggatccaaagaatattggcgaaaagctgtcatcc
gaaaaactctccccgattctgtcagtttacaaggccaaggaccgggaagacgggatcaga
atcgtcaaagccctgcttgactaccaaggtgctggccacaatgccgccatccaaatcggc
tcccaaaacgatccattcatcgatgaatacggcaaggctgtccaagcttccagagtcctg
gttaaccagccggacgctttgggcgggatcggcgatatctacagtgatggcctacggcca
agcttgactttggggactggttcatgggggaagaactccctgtctcacaacctgtcgacc
agcgacctcttgaacatcaagaccattgccaagcggcggaaccggccgcaatggatccgc
ctgccggagaagattttttacgaaaaagactccattacctatctttcagatgaaaatgag
caggaaatcagccgggcctttatcgtcgctgacccgggcatggtcaagttccacttcgtt
gacaaggtctatgaacagctggctttaagagacaagcaggtcgacacggccatctacagt
gaagtcttgcctgacccaccgctgagccaggcgatcaagattgccaagcagatgaagaag
tttgcaccagataccattatcgccatcggcggcggcagcgccctggacgtctccaagatc
gcccgctacatctacgaatacagcctggaccaggaagatggctggctggacaactacgac
aatgtgagcgagctcttcaaggaactgcagcagaagtttgtcgatatcagaaagcggatc
gtcaaattcaagcatgagacccggaccagtctggtctgcatccctaccacgtcagggact
gggtcagaagtcacaccttacgccgtcatcaccgatgacaagcagcatgtcaagtacccg
ttgactgactacgaactgactccgcaagtcgcaatcgttgacccggccttcgtcatgacc
gtgccaaagcataccgtggccttctccggcttcgactgcctctcccactctttggaaagc
tacgtctctgttgcagccagtgacttcacccggccatggtcacttaaggccatccagcta
atcatgaacaacctggaagcctcttacaagtacgacccgcagcacccgacttatgaagga
gaaaaagcccgggaaaacatgcactacgcggcaaccttggccgggatggcttttgccaac
gccttcttgggcctcaaccactccattgcccacaagctgggcggggccttcggcttcccg
cacggcctttgcatttcaattgccatgctgccagtcatcaagttcaacggtgccagtggc
aatgtcaagcggacgccttatccaagatatgaagtttaccgggcccaaaaagactatgct
gatatcgcccgcagcttaggcctgccaggcaagagtgacgcggaactggttgattctctt
tgcaagcggatccgggaactgatgaaggcctgcgatattgaaccctccctttcagccaac
ggggtcagcaaggaagcctttgacgccgccttgccagccatgatcgaccgggtctacgat
gaccagtgcacggtgcagaacccgcgccagccaagcatggctgaaatcaagcagctcttg
ctcagcatgtattaa

DBGET integrated database retrieval system