KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0877Help
Entry
LDBND_0877        CDS       T01360                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LDBND_0877
Enzymes [BR:lde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LDBND_0877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
898948..900039
Genome map
AA seq 363 aa AA seqDB search
MEIKKINNRQQTFSGNVTISFNANTEELPKLINLLADQTANLSISSSLVIATFTQTELAA
VIKSWPEVFGAENGTLQQIQAASQIHFKGRGFDFDITTKPIIYSILNLTPDSFYDGGRNA
SVDGVMKRIEADLAAGTAIFEVGGKSSKPHFDDISAEEEWGRIKPFLDAIHKRFPNIVLA
IDSNTNAVIEEALKNGIQIINDIDGFNSQAKLNLIAKYKPAVVTMFNGRNFNEQTETLSK
TMMDFFTHTISDLTGVGLEKENIVIDPGVGFSDHNTLAFDLIKMKLTKLMAEFQTPIMIA
ISRKSFAKRLFNLDSADDRLIPTLLFEAFMTVLGGRVIRVHDAKETRQLIDAFELLKDQL
LLK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaaaataaacaatcgtcaacaaacattcagcggcaacgtcaccatttct
tttaatgcgaatacagaagaattacccaaattaattaatctgttagctgaccagactgca
aatctttcgatttcgtcatcgctagtcatcgcgacatttacgcaaacggaattggcagct
gtaattaaaagttggccagaagtgtttggcgctgaaaacggtacgctgcagcaaatccag
gcagcttctcaaatccattttaagggtcggggatttgactttgatattacgaccaaacca
attatttattcgattttaaacttgacgccggattcattttacgatggtgggagaaacgct
tcagtcgatggggttatgaaacgaattgaagcagacctggcagccggaactgccatcttt
gaagtcggtggcaaatcttccaagccgcactttgatgatattagtgctgaagaggagtgg
gggcgaattaaaccgtttttggacgctattcacaagcgttttccaaatattgttttggca
attgattccaatacaaacgcggttattgaagaagcactaaaaaatggtattcaaattatt
aacgacatcgatggctttaattctcaagcgaaactgaatttaattgctaaatacaaacct
gctgttgtaacgatgtttaatggtcggaacttcaatgagcaaacggaaaccttatcaaaa
acaatgatggatttctttacacatacaattagcgatttaacaggcgttgggcttgaaaaa
gaaaacattgtgattgacccgggcgttggcttttctgatcataatacgttagcttttgat
ctgattaagatgaaattaacgaaattaatggcagaatttcaaacaccgattatgattgca
atttcgcgaaaaagttttgctaaacggctgtttaatttggactcagcggatgatcgattg
attccaacgctgctatttgaagcatttatgacggttcttggcggtcgggttattcgggta
catgatgcaaaagaaactcgtcagctaatcgatgcttttgagttgctaaaagatcagcta
ttgctaaagtaa

DBGET integrated database retrieval system