KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0892Help
Entry
LDBND_0892        CDS       T01360                                 

Definition
phosphomevalonate kinase
Orthology
K00938  
phosphomevalonate kinase [EC:2.7.4.2]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lde00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(914835..915917)
Genome map
AA seq 360 aa AA seqDB search
MITEKAPGKLYIAGEYAVLEQDCPAILVALDQYVRVSIKPSSSDTGLIHSKQYSQDSIHW
VRRGSKIVIDNRDNPFEYILSAISFTERYCLEQKVKMDVYDLFVNSDLDSADGKKYGLGS
SAAVTVATVKAILRFYGVQASKDLIYKLSTISHYSVQGNGSAGDIAASVYGGWIAYQTFN
NLWLKEELASKSLSAVVGEAWPGLKIQQLVPPKGMKLLIGWSQQPASTSRLVDKTNANKN
NLRTEYAKFLADSRKCVLQMIRGFEEANIALIQKQIGINRRLLQHFAAINNIAIEIPRLT
ELIEIANKFGGAAKTSGAGNGDCGIVIVNKDTDIDRLRKEWVKNNILPLEFHIHQSELTY
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgattactgaaaaagcgccaggcaaactttacattgccggggaatacgctgtcttggaa
caagattgtccagccattctggtcgcccttgaccaatacgtcagggtctcaatcaagcca
agcagcagtgacaccggtttgattcactccaagcaatactcccaggactccattcactgg
gtcagacgggggtcaaagatagtgatcgacaaccgggataatccatttgaatacattctg
tccgcaatttctttcactgagagatactgcctggaacagaaggtcaagatggacgtttac
gacttgtttgtcaattctgacctggattccgcagatggcaagaagtatggcctgggttct
tcagccgcggtcacggtcgcgacggtcaaggcaatcttgcgcttttacggtgtccaggca
agtaaggacctgatttacaagctctccacaatttctcactactcagtccaaggcaacggc
agcgccggcgatatcgcggccagcgtctacggcggctggatcgcctaccagaccttcaac
aatctctggctgaaagaagaactggcaagcaagtccctgtcagcagtggtcggtgaagcc
tggccaggtctgaagatccagcagctggttccgccgaagggcatgaagctcttgattggc
tggagccagcagccagcttcaacttcccgcctggttgacaagactaacgccaacaagaac
aacctgcggactgagtacgccaagtttttggcagactcacgcaagtgcgttttgcagatg
atccgcggttttgaagaagcaaacatcgctttgattcaaaagcagatcggcatcaaccgc
cgcttgctgcagcattttgccgctatcaacaatattgctatcgaaattccccgcttgact
gagctgatcgaaatcgccaacaagtttggcggcgcggctaagaccagcggcgcgggcaac
ggcgactgcggcatcgtcatcgtcaacaaggacaccgatattgaccgcctccgcaaggaa
tgggtcaagaacaacatcctgcccctggaatttcacattcaccaatctgaattaacttac
taa

DBGET integrated database retrieval system