KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0929Help
Entry
LDBND_0929        CDS       T01360                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LDBND_0929
   01230 Biosynthesis of amino acids
    LDBND_0929
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBND_0929
  Energy metabolism
   00680 Methane metabolism
    LDBND_0929
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LDBND_0929
Enzymes [BR:lde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     LDBND_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964639..965262
Genome map
AA seq 207 aa AA seqDB search
MTTFYFIRHGQTFANKAGLKQGTINTPNTYLTDLGKEQAQKLADQFDISNFDRLFVSPLV
RTKQTAEILNKKAGLPVETDDRLLEISYGDWDGQKNSELMAEYPNYFSPLVNDVTEDYVQ
AAPKAESFAHVEMRTAEFVEEISQKYPEDQIVVVTHGFTVRSFAINATGGQGLQILEPDN
CSVTKILVDPLSFKQHLVYYNRTVTAF
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccacattctactttatccggcacgggcaaacctttgccaacaaggcgggcctaaag
caggggaccatcaatactcccaacacctacttgaccgacctgggcaaggagcaggcgcaa
aaactggctgaccagttcgatatcagcaatttcgaccgccttttcgtttcccccttggtc
agaaccaagcagacagccgaaattttgaacaagaaggccggcctgccggttgaaacggac
gaccgcctgctggagatttcctacggggactgggatgggcaaaagaacagcgaattgatg
gctgaatacccgaattacttttctcccctggtcaatgacgtgacggaagactacgtgcag
gcagccccaaaggcggaaagctttgcccatgtggaaatgcggaccgctgaattcgtggag
gaaatcagccaaaagtatccagaagaccagatcgtggtagtgacccacggcttcacggtc
agatcttttgccattaatgccacgggcggccagggcctgcagatcctggaaccagacaac
tgctccgtcaccaagatcctcgttgaccccctgtcatttaagcagcacctggtctactac
aaccggacagtgactgctttttag

DBGET integrated database retrieval system