KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0929Help
Entry
LDBND_0929        CDS       T01360                                 

Definition
(GenBank) Phosphoglycerate mutase family protein
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADQ60972
UniProt: E4SZI5
Position
964639..965262
Genome map
AA seq 207 aa AA seqDB search
MTTFYFIRHGQTFANKAGLKQGTINTPNTYLTDLGKEQAQKLADQFDISNFDRLFVSPLV
RTKQTAEILNKKAGLPVETDDRLLEISYGDWDGQKNSELMAEYPNYFSPLVNDVTEDYVQ
AAPKAESFAHVEMRTAEFVEEISQKYPEDQIVVVTHGFTVRSFAINATGGQGLQILEPDN
CSVTKILVDPLSFKQHLVYYNRTVTAF
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccacattctactttatccggcacgggcaaacctttgccaacaaggcgggcctaaag
caggggaccatcaatactcccaacacctacttgaccgacctgggcaaggagcaggcgcaa
aaactggctgaccagttcgatatcagcaatttcgaccgccttttcgtttcccccttggtc
agaaccaagcagacagccgaaattttgaacaagaaggccggcctgccggttgaaacggac
gaccgcctgctggagatttcctacggggactgggatgggcaaaagaacagcgaattgatg
gctgaatacccgaattacttttctcccctggtcaatgacgtgacggaagactacgtgcag
gcagccccaaaggcggaaagctttgcccatgtggaaatgcggaccgctgaattcgtggag
gaaatcagccaaaagtatccagaagaccagatcgtggtagtgacccacggcttcacggtc
agatcttttgccattaatgccacgggcggccagggcctgcagatcctggaaccagacaac
tgctccgtcaccaagatcctcgttgaccccctgtcatttaagcagcacctggtctactac
aaccggacagtgactgctttttag

DBGET integrated database retrieval system