KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_0932Help
Entry
LDBND_0932        CDS       T01360                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LDBND_0932 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LDBND_0932 (pyrB)
Enzymes [BR:lde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LDBND_0932 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
966779..967789
Genome map
AA seq 336 aa AA seqDB search
MTTVSQNQVVVETEDKQDNLLRLPYFVSVEQLSADDVLHLLQRAQYFKNGGEVPALSRPI
FCTNMFFENSTRTHTSFEVAERRLGLTVIPFDPSHSSVNKGENLYDTELTMASLGIELSV
IRHPENAYYNEIIHPKEGQHLQMGLVNAGDGSGQHPSQSMLDMMTIYNEFGHFDGLKIMI
VGDLTNSRVARSNMEILNTLGAEVYFSGPEYWYDAEEFSKYGTYVKNIDDEIPELDVLML
LRVQHERHNGAEAKTEQLFDAKDYNAAYGLNQRRYDMLKDDAIIMHPGPINRGVEWDGDL
VEAPKSRYAVQMHNGVFVRMAMIEAVLRGRKLGGLE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgttagccaaaaccaagtcgttgtcgaaactgaagacaagcaagacaacttg
ctccgtctgccttactttgtcagcgttgaacaactgagcgccgacgacgtgctgcacctg
ctgcaaagagcccaatacttcaagaacggcggggaagtaccagccttgagccggccaatc
ttctgcaccaacatgttctttgaaaactcaacccggacccacaccagctttgaagttgct
gaaagaaggctgggcttgactgtaatcccatttgacccatcccactcttcagtcaacaaa
ggggaaaacctctacgacactgaactgactatggcatctctgggcatcgaactcagcgtg
atcagacacccggaaaacgcctactacaacgaaatcatccacccaaaggaaggccagcac
ctgcaaatgggcctggttaacgctggtgacggttccggtcagcacccatcccaaagcatg
ctggacatgatgaccatttacaacgaattcggccacttcgacggcttgaagatcatgatc
gtcggtgacttgaccaactcccgggttgcccggtcaaacatggaaatcttgaacaccctg
ggcgcggaagtctacttctcaggtccggaatactggtacgacgctgaagaattcagcaag
tacggcacttatgtcaagaacattgacgatgaaatcccagaactggacgtcttgatgctg
ctcagagttcagcacgaacgccacaatggggcagaagccaagactgaacagctctttgat
gccaaggactacaacgctgcctacggcttgaaccaacgccgctacgatatgcttaaggat
gacgccatcatcatgcacccgggcccaatcaaccgcggagttgaatgggacggtgacctg
gttgaagcacctaagtcccgctacgctgtccaaatgcacaacggggtctttgtcagaatg
gccatgattgaagctgttctgcgcggacgtaagttgggaggccttgaataa

DBGET integrated database retrieval system