KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1125Help
Entry
LDBND_1125        CDS       T01360                                 

Gene name
melA
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LDBND_1125 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    LDBND_1125 (melA)
   00600 Sphingolipid metabolism
    LDBND_1125 (melA)
Enzymes [BR:lde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LDBND_1125 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1159499..1161703)
Genome map
AA seq 734 aa AA seqDB search
MSELIEFDEKQQVFHLHNQEVSYIFSVVKGGTLSHLYFGKRVRGYHGELAYPAVDRGFSG
NLPGDLDRTFSRDTLPKEYSGAGEMDYHSPATIVRQANGSNAVFLHYAGYEIAPGKPKLL
GLPAAYVENNDEAETLTVKLVDDLTGLEYDLLYTIYRDRDVIARSVQIVNKGKESVHLEK
AASMQMDLVGRDLEAITLPGAHVNERHPQRSRLIQGRHVFESRRGTSSHQMNPFVAFVDP
KTDEFSGDAWGLALVYSGNHEFELEKDQLDQLHVTVGINEYNFSWKLTPGASFQTPEVLL
VYSNAGLNGMSQTYHSLILDRVIRSKFKRSPRPILVNNWEATYFDFNEDKLKPIVDEAKK
LGIEMFVLDDGWFGHRDDDNSSLGDWQVYEKKFPQGLKHFADYVHEQGLKFGLWFEPEMI
SFDSDLYRAHPDYLMQVPGRKPSPSRNQYVLDLGRKEVRDNIFAQMTKILDNSGVDYVKW
DMNRHLSDIYENDLPADQQGEVYHRYVLGLYDLSERLVDRYPDILLEGCSGGGGRFDIGM
AYYCPQIWASDNSDAIARLVIQYGTSLVYPQSMMTSHVSVSPNEQNGRITPFDTRGAVAM
CGDLGYELDLTKMSDEDKAAVKQQVADYKQIRGLTQYGKFYTLKAPLDSNQAAWMTVSDD
QNEAVVTTVNIMSYAQPYLTKTKLAGLDPDKNYEDLATGKVYGGDELMNLGFYDPTQPHK
DFTAKMYHFKAIAD
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagttgattgaatttgatgaaaagcagcaggtcttccacctgcacaaccaggaa
gtttcttacatcttctccgtcgttaaaggcggcaccttgagccacttgtactttggcaag
cgggtcagaggctaccacggggaattagcctacccagccgttgaccgcggcttctctggc
aacctgccaggcgacttggaccggactttttcccgggataccttgcctaaggaatacagc
ggggctggggaaatggactaccactcaccagcgaccattgtccgtcaagccaacgggtca
aacgcggttttcctgcactacgccggctatgagatcgcgccaggcaagccaaaattgcta
ggcctgccagctgcctacgttgagaataatgatgaagctgaaaccttgacggtcaagctg
gttgacgacttgaccggccttgaatacgacttgctctatacgatttaccgtgaccgcgat
gtgatcgcccgcagcgtccagatcgtcaacaagggcaaggaaagcgtccacctggaaaag
gctgcttccatgcagatggatctggttggccgggacttggaagccatcaccttgcctggg
gcccacgtcaatgagcgccacccgcaaagaagccgcttgattcaaggccgccacgtcttt
gaatcccgccgcggcacttccagccaccagatgaacccattcgtcgcttttgttgacccg
aagacggatgagttcagcggggatgcctggggcttggccttggtctactcaggcaaccat
gaatttgaactggaaaaggatcagctggaccaactgcacgtcacggttgggatcaacgag
tacaacttctcttggaaactgaccccgggcgccagcttccaaactccagaagtcttgctg
gtctactcaaacgccggcttaaacgggatgagccagacctaccacagcttgattttggac
cgggtaatccgcagcaagttcaagcggtctccgcggccaatcctggtcaacaactgggaa
gcaacctactttgacttcaatgaagataagctgaagccaatcgttgatgaagctaaaaag
ttgggcattgaaatgttcgttctggacgatggctggtttggccaccgcgatgacgacaac
agctccctgggcgactggcaggtctacgagaagaagttcccgcaaggattgaagcacttt
gctgactatgtccatgaacagggcttgaagttcggcctgtggtttgagccggaaatgatc
tcctttgactccgacctttaccgggctcaccctgactacttgatgcaggtgccaggcaga
aagccaagcccatctcggaaccaatatgtactggatttgggccggaaggaagtccgtgac
aatatctttgctcagatgaccaagattcttgataatagtggtgtcgactatgttaaatgg
gatatgaaccgtcacctgtctgacatctacgaaaatgatttgcctgctgaccaacaagga
gaagtttaccaccgttatgttttgggcctgtacgacctatctgagcgtttggtcgaccgt
tatccggacatcttgctggaaggctgctcaggcggcggtggccgctttgacatcggcatg
gcctactactgcccgcaaatctgggccagcgacaacagcgacgcgattgcccgcctggtc
atccaatacggcaccagcctggtctacccgcagtcaatgatgacctcccacgtttccgtt
tcgccaaacgagcaaaacgggcggatcacgccatttgacaccagaggtgccgtagccatg
tgcggtgacttgggctatgaattggacttgaccaagatgtctgatgaagacaaggcagcg
gttaagcagcaagtggctgactataagcagatccgtgggctgacccaatatgggaagttc
tacactttgaaagctccgcttgatagtaatcaagctgcttggatgacggtcagtgatgac
cagaatgaagccgtggttacgactgttaacatcatgtcctacgcccagccatacctgacc
aagaccaagctggccgggctggacccagacaagaactatgaagatctggccaccggcaaa
gtctacggcggggatgagctgatgaatttgggcttctatgacccaacccagcctcataaa
gactttactgctaagatgtatcacttcaaagcaattgctgattag

DBGET integrated database retrieval system