KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1131Help
Entry
LDBND_1131        CDS       T01360                                 

Definition
phospho-beta-galactosidase i
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBND_1131
Enzymes [BR:lde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LDBND_1131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1166365..1167810
Genome map
AA seq 481 aa AA seqDB search
MYSAKMPKGFLWGGAVSAHQLEGAWDVGGKGVSVADVMTVGSATKPREITDGVLPGKNYP
NHSAIDFYHHYKEDIKLLAGMGFKAFRTSIAWTRIFPNGDDAEPNEAGLKFYDDLFDEMH
KYGIEPVITLSHFEMPFNLAKNYGGFTNRKTIDFFVRFAEVCFKRYKDKVKYWMTFNEIN
NQSAFNNDFLMATNSGILFKEGMTDEEKEAAMYQAAHYEFVASALAVKIGHKISPDFKIG
LMINYSPVRPLTPSSEDTLLADKFEQHRDFFSDVQVFGEYPKAIEAYIEKHGYRPDITDE
DRVVLKEGTVDYVAFSYYQSTTVSSEKVSADELSDLEKAVAVNPTLERSDWGWEIDPVGL
RLALNHLTDRYHLPLFIVENGLGAYDKVEDGKIHDPYRVDYLKKHISEMEKAVTIDGVDL
MGYLPWGPIDLVSAGTGQMDKRYGFIYVNKNDQGVGDLSRTPKDSYYWYKKVIASNGTDL
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtattctgcaaaaatgcctaaaggatttttatggggcggcgcggtttctgcccaccaa
cttgaaggtgcctgggacgtaggcggcaagggcgtgtccgttgccgacgtcatgaccgtc
ggttcagccactaagccgcgggaaatcaccgacggcgtattgccggggaagaactacccg
aaccactcagccatcgatttctaccaccactataaagaagacatcaaactcctggccggg
atgggcttcaaggctttcagaacctccattgcctggaccagaatcttccctaatggtgac
gacgctgaacctaatgaagcaggcttgaagttctacgatgacctttttgacgaaatgcac
aagtacggcattgaaccagtcatcaccttgagccactttgaaatgccattcaacctggcc
aagaactacggcggcttcaccaaccgcaagaccatcgacttcttcgtccgctttgctgaa
gtctgcttcaagcgctacaaggacaaggtcaagtactggatgaccttcaacgaaatcaac
aaccaaagtgccttcaacaacgacttcttgatggctaccaactctggtatcctctttaaa
gaaggcatgactgatgaagaaaaagaagccgccatgtaccaggctgcccactatgaattc
gtggccagcgccctggcagtcaagatcggccacaagatcagccctgacttcaagatcggc
ctgatgatcaactactcaccagtccgcccgctgacgccaagctcagaagacaccctcttg
gctgacaagttcgaacagcaccgggacttcttctcagacgtccaagtcttcggcgaatac
ccgaaggcaattgaagcctatattgaaaagcacggctaccggccagacatcactgacgaa
gacagagtcgtccttaaagaagggaccgttgactacgtggccttctcttactaccagtca
actactgtctccagcgaaaaggtctcagctgatgaactgagcgacctggaaaaggcggtt
gcggttaacccgactttggaaagaagcgactggggctgggaaattgacccggttggcctc
cgccttgctttgaaccacttgactgaccgctaccacctgcccctcttcatcgttgaaaac
ggcctgggggcctacgacaaggtcgaagacggcaagattcacgacccataccgggttgac
tacctgaagaaacatattagcgaaatggaaaaggcagttacgatcgacggcgttgacctg
atgggctacctgccatgggggccaatcgacctggtttctgcagggactggccaaatggac
aagcgctacggtttcatctacgtcaacaagaatgaccaaggagtcggcgacctcagcaga
accccaaaggactcctactactggtacaagaaggtcattgcatccaacgggactgacctc
gactaa

DBGET integrated database retrieval system