KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1522Help
Entry
LDBND_1522        CDS       T01360                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LDBND_1522 (ruvA)
Enzymes [BR:lde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LDBND_1522 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1576180..1576773)
Genome map
AA seq 197 aa AA seqDB search
MYEYFEGTITVVNPAYVVIEVAGIGYRILTPTPYAYKDGDKARIYVEQVVRENGMTLYGF
KSQQDKVLFNKLNEVSGIGPKSALAIMAAEDNGALASAIESGEVSYLTRFPGIGKKTAAQ
IVLDLRGKMGNYVAENLFTEDEPVKSVFPALEDALLALGALGYSQKEVDRIKPKLKKLPE
MSADEYIKQGLGLLLKK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtattttgagggcaccattaccgtggttaatccggcctatgtcgtgattgaa
gtggctgggatcggctaccggatcctgaccccgaccccttatgcctataaagatggggac
aaggcccggatctacgttgaacaggtcgtccgggaaaacgggatgaccctctacggcttc
aagagccagcaagacaaggtcctcttcaacaagcttaatgaagtttccgggatcggtcct
aagtctgccctggccatcatggccgctgaagacaacggagccctggcttccgccattgag
agcggcgaagtttcctacttgacccgtttcccggggatcggcaagaagacggcagcccag
atcgtcctggacttgcgggggaagatgggcaactatgtggcggaaaacctctttaccgaa
gatgaaccggttaagtctgttttcccagccctggaagacgctctcctggcccttggggct
ttgggctacagtcaaaaggaagttgaccggatcaagccgaaactgaagaaattgccggaa
atgtccgctgacgaatacatcaagcaggggctgggccttttgctgaagaaataa

DBGET integrated database retrieval system