KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1541Help
Entry
LDBND_1541        CDS       T01360                                 

Gene name
recR
Definition
(GenBank) Recombination protein recR
  KO
K06187  recombination protein RecR
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
lde03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LDBND_1541 (recR)
DNA repair and recombination proteins [BR:lde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     LDBND_1541 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LDBND_1541 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 Toprim_2 HHH_8
Motif
Other DBs
NCBI-ProteinID: ADQ61568
UniProt: E4SWB0
Position
complement(1593545..1594144)
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIARLIDSFMKLPGIGEKTATRLAFYAMDMPKEDVDEFAQALVDVKEKLRQCSVC
GNITEQDPCAICSNPARDRSTIMVVEEAKDVMAFENMGEYDGLYHVLHGVLSPMDGIGPE
QINIKSLIVRLQKNDAAKEVILALNSTPEGESTAMYISRLIKPAGLKVTRLAAGLAVGSD
IEYANLITLKRAVQGRTEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatacccattgccaattgcccgcttgatcgattccttcatgaaactgccgggcatc
ggtgaaaagacggcgacccgcctggccttttacgccatggacatgcctaaagaagacgtg
gacgaattcgcccaggctctggtcgacgttaaggaaaagctgcgccagtgctcggtctgc
ggcaacattaccgaacaagacccttgcgccatctgcagcaatccagcccgggaccggtca
accatcatggtggttgaggaagccaaggacgtgatggcctttgaaaatatgggcgaatat
gacggcctctaccatgtcctgcacggggtcttgtcaccgatggacgggatcgggccggag
cagatcaacatcaagtccttgatcgtccgcctgcagaaaaatgatgctgccaaagaagtc
atcctggcccttaattccaccccggaaggggagtcaacggccatgtacatttcccgcttg
atcaagccggccggcctcaaggttacccggctggccgcgggcctggcggtcggctcagac
attgagtatgccaacttgatcactttgaagcgggcagttcaaggtagaacggagctatag

DBGET integrated database retrieval system