KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1541Help
Entry
LDBND_1541        CDS       T01360                                 

Gene name
recR
Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LDBND_1541 (recR)
DNA repair and recombination proteins [BR:lde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LDBND_1541 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1593545..1594144)
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIARLIDSFMKLPGIGEKTATRLAFYAMDMPKEDVDEFAQALVDVKEKLRQCSVC
GNITEQDPCAICSNPARDRSTIMVVEEAKDVMAFENMGEYDGLYHVLHGVLSPMDGIGPE
QINIKSLIVRLQKNDAAKEVILALNSTPEGESTAMYISRLIKPAGLKVTRLAAGLAVGSD
IEYANLITLKRAVQGRTEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatacccattgccaattgcccgcttgatcgattccttcatgaaactgccgggcatc
ggtgaaaagacggcgacccgcctggccttttacgccatggacatgcctaaagaagacgtg
gacgaattcgcccaggctctggtcgacgttaaggaaaagctgcgccagtgctcggtctgc
ggcaacattaccgaacaagacccttgcgccatctgcagcaatccagcccgggaccggtca
accatcatggtggttgaggaagccaaggacgtgatggcctttgaaaatatgggcgaatat
gacggcctctaccatgtcctgcacggggtcttgtcaccgatggacgggatcgggccggag
cagatcaacatcaagtccttgatcgtccgcctgcagaaaaatgatgctgccaaagaagtc
atcctggcccttaattccaccccggaaggggagtcaacggccatgtacatttcccgcttg
atcaagccggccggcctcaaggttacccggctggccgcgggcctggcggtcggctcagac
attgagtatgccaacttgatcactttgaagcgggcagttcaaggtagaacggagctatag

DBGET integrated database retrieval system