KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1552Help
Entry
LDBND_1552        CDS       T01360                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lde00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lde00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1602791..1603738
Genome map
AA seq 315 aa AA seqDB search
MSSLSQKLASLFLIDSTGDFTENLRLLEQYQPAGLLLFAKDLAGLSEKAVKERLAIYRQA
RPGLLLAIDQEGGLVSRLSTLYPNRSYPSQAELLKKGADFFLAENQKTALKLKDLGINLN
FAPVADLALDPASFIYSRTLQAGAEETGPAIAAFIKLYRQLGVASCAKHFPGYGDAGDTH
QAPAKDLRSLKEAQLDLLPFKAAIAASVPTIMVAHLQVACYSPGPASLSPEIYRLLKEDL
HYFGVAITDDLAMAAARESSCPELLALKAGADLLLGGKLENLPILEAAAESGELPKERIK
DALVRVQTLQDDYSL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacttagtcaaaaactggccagccttttcctaatcgacagcactggcgatttt
actgaaaacctccgacttttggagcagtaccagccagccggcctcctactctttgccaaa
gacctggcgggcctaagcgaaaaggctgttaaagagcggctggcgatttaccggcaggcc
cggccaggtttgctgctcgccattgaccaggaaggcggcttagtcagccgcttgtccacc
ctttacccaaaccggtcttaccccagccaagctgaacttttgaaaaagggggctgacttt
ttcttagcagaaaaccaaaagacggccctgaaattaaaagatttaggcatcaacttgaac
tttgctccggtggctgatcttgcgcttgatccggccagtttcatctacagccggaccctg
caagcaggagctgaggaaaccgggccggcaatcgcggcctttatcaagctctaccggcag
ctgggagtcgcctcctgcgccaagcattttcctggctacggggatgccggcgacacccac
caggctccggctaaagaccttagaagccttaaagaagcccagctggatcttttacctttt
aaagctgcgatcgcggcgagcgtgccgactatcatggtggctcacttgcaagttgcctgc
tatagccctggccctgcttccctctccccggaaatctaccgcctgctcaaggaggacctt
cattatttcggcgtggccatcaccgacgacttagctatggcggcggcgcgagagagcagc
tgcccggaacttttggccctaaaggccggagccgacctccttttaggcggcaaattggaa
aacttgccaattttggaagcagccgcagagagcggtgaattgccaaaagagcggatcaaa
gacgctctggtccgggtccaaaccctgcaggacgattattctctttaa

DBGET integrated database retrieval system