KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1582Help
Entry
LDBND_1582        CDS       T01360                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lde00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LDBND_1582 (gltX)
Enzymes [BR:lde01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LDBND_1582 (gltX)
Amino acid related enzymes [BR:lde01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LDBND_1582 (gltX)
Transfer RNA biogenesis [BR:lde03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LDBND_1582 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1625942..1627444)
Genome map
AA seq 500 aa AA seqDB search
MANKKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTLVLRIEDTDTARNVEGGAESQ
IENLHWLGIDWDEGPDIGGDYGPYKQSERKDIYQKYIDQLLEEGKAYYSFKTEEELEAQR
EEQRAMGIAPHYVYEYEGMTTDEIKQAQDEARAKGLKPVVRIHIPEGVTYEWDDIVKGHL
SFESDTIGGDFVIQKRDGMPTYNFAVVVDDHLMEISHVLRGDDHISNTPKQLCVYEALGW
EAPVFGHMTLIINSATGKKLSKRDESVLQFIEQYRELGFLPEAMFNFITLLGWSPVGESE
IFSKREFIKQFDPARLSKSPAAFDQKKLDWVNNQYMKTADRDELLDLALHNLQEAGLVEA
NPAPGKIEWVRQLVNMYANQMSYTKQIVDLSKIFFTEAEYLTDEEVEEIKKDEARPAIEE
FKKQLDKLDNFTAKKIMDAIMATRRETGIKGRKLFMPIRIATTRSMVGPGIGEAMELMGK
DTVMKHLDLTLKQLSEAGIE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ttggctaataagaaaatccgcgtgagatacgctccgtcaccaactggccacttgcacatt
ggtaacgcgcgtactgctctgtttaactatctgtttgcacgtcacaacaaggggactttg
gttctgagaatcgaagacactgacaccgccagaaacgttgaaggcggggctgaatctcaa
atcgaaaacctgcactggctggggatcgactgggatgaaggtccggacatcggcggtgac
tacggcccttacaagcagtccgaaagaaaggacatctaccaaaagtacatcgaccagctg
cttgaagaaggcaaggcttactactcctttaaaactgaagaggaactggaagcccagcgt
gaagaacagcgggccatggggattgctcctcactatgtctacgaatacgaaggcatgact
actgacgaaatcaagcaggcacaagacgaagcccgggccaagggcttgaagccagttgtc
cgcattcacattccagaaggcgtgacttacgaatgggacgacatcgttaagggccacttg
agctttgaatccgacactatcggcggtgacttcgtcatccaaaagcgcgacgggatgcca
acttacaactttgccgtcgttgtcgacgaccacttgatggaaatcagccacgtgctccgg
ggcgatgaccacatctctaacacgccaaagcagctttgcgtttacgaagctttgggctgg
gaagctccagtcttcggccacatgactttgatcatcaactccgctactggcaagaagctg
tccaagcgtgacgaatcagtcctgcagttcatcgaacaatacagagaacttggtttcctg
ccagaagccatgttcaacttcatcactttgctgggctggtcaccagttggcgaaagcgaa
atcttctccaagcgcgaattcatcaagcaatttgacccggcccgtctgtccaagtcccca
gctgcctttgaccaaaagaagctggactgggtcaacaaccagtacatgaagacggctgac
agagatgaacttttggacctggccctgcacaacctgcaagaagctggcctggttgaagct
aacccagctccaggcaagatagaatgggtaagacaattggtgaacatgtatgccaaccaa
atgtcctacaccaagcaaatcgttgacttgagcaagatcttcttcactgaagcagaatac
ctgactgacgaagaagtggaagaaatcaagaaggacgaagctcgtccggcgattgaagaa
ttcaagaagcaactggacaagcttgacaacttcacggccaagaagatcatggacgccatc
atggctacccggagggaaactggcatcaagggccgcaagctcttcatgccaatccggatc
gctactacccggtcaatggtcggccctggcatcggcgaagctatggaattgatgggcaag
gacacggtcatgaagcacctggacttgaccttgaagcagcttagcgaagctggcatcgaa
taa

DBGET integrated database retrieval system