KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1592Help
Entry
LDBND_1592        CDS       T01360                                 

Definition
sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LDBND_1592
Enzymes [BR:lde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LDBND_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1636513..1637379)
Genome map
AA seq 288 aa AA seqDB search
MKIDVLGTAFMDVVFQTPESGFEADNVVFSSMARISAGGNGCNLAINLVQKEVETKFYGY
IGDDYPGSVIIKDFVKNNVTWNQNCHESTGISLVLVDQSGERSVTSYQGMNDEFELSAAE
LEDLDNDIAVCGLGLLPHLETDLKPLIARAHSNGHTIYAGTTGDTNHLYQFIKEGKYSGL
DFLFMNNLEAQRLCQLPNLIDCGKELVNECGIKNVIITEGEGGATMISQNDVYHVDANKV
NCVDSTGAGDAFMAGFIAQYSSDHDRIKSLIAANNSGGENVQFFGAVR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgatgtattaggaacagcgtttatggatgtagtatttcaaacaccagaatct
gggtttgaagcagataatgtcgtattctcaagtatggccagaatctcggctggtggcaat
ggttgtaatttagcgattaatttggttcaaaaggaagttgagacaaaattctatggttat
atcggggatgattatccgggcagtgtgatcataaaggattttgttaagaacaatgtgact
tggaaccaaaactgtcatgagtcaactgggatttccttggtattggtagatcagagcggg
gaaagatcggttacaagttatcaagggatgaatgatgaattcgaattatccgcagcggaa
ttagaagatttggataacgatatagcggtatgtggactagggctattgcctcatcttgaa
acggatttgaagccgctgattgctagagctcacagtaatggtcataccatatatgcagga
acaacgggagatacgaatcacttgtatcaatttatcaaagagggtaagtattcgggatta
gactttttgtttatgaataatttggaggcacagagattgtgtcaattacctaatttgatc
gattgtggtaaagagttagttaatgaatgtggcataaaaaatgtgatcatcactgaggga
gaaggcggagcaactatgatttctcagaatgatgtatatcatgtagatgcaaataaggta
aactgtgtagactcaacaggtgcgggggatgcctttatggcaggatttattgcccaatat
tcttctgaccatgacagaataaagtcactgattgcagcaaacaattctggaggcgaaaac
gttcagttctttggagcagtgaggtaa

DBGET integrated database retrieval system