KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1648Help
Entry
LDBND_1648        CDS       T01360                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lde00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lde00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1693322..1694257)
Genome map
AA seq 311 aa AA seqDB search
MSVKLLNYGATLEDVAIPVDGAKRHVILSLKQAEDYSKERNFLGGTVGRIAGRVWHGQWK
NGDHILQLPINDGENHIHGGFGTDQQVWSFRPEQGEDFVSVHFSLLDPDGHNGFPGNLQL
EATYTLNNSGELLYDLTAYSDKLTIFNPTNHTYFCLDDLGTKIDQTKLFLDADYYLPVKE
DGLPVGGMEAVEGTAFDFRMGKSMEDALKSGDAQIALRKGLDHPFILNGQKTAAKVVASD
GKVSMKMGTNAPAIVIYTANSFGKGEKQVKDLPQYGGLTLEAQNAPASGNDLREIHLEPG
KSWQRQVSWKF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaagctcttgaactacggggccactttagaagacgtggctatcccggtggat
ggagcaaagcgccatgtcatcctctctttaaagcaggctgaggactacagcaaggaacgc
aatttcttaggcgggacagttggccggattgccggccgggtctggcacgggcagtggaag
aacggtgaccatatcctccaattgccaatcaacgatggcgaaaaccacattcacggcggc
tttgggaccgaccagcaggtttggtctttcagaccagagcaaggggaagactttgtttcc
gttcacttcagcctgcttgatccagatggccataacggctttcccggcaacctgcagctg
gaggcaacttatactctgaataattctggtgaacttttgtatgatttgacagcctactca
gacaagttgacaatttttaacccgaccaaccatacttacttctgcctggacgacctgggg
accaagatcgatcagaccaagcttttccttgacgcggactactatctgccagtaaaggaa
gacggcctgccggttggcggaatggaggcagtcgaaggcacggcttttgacttcagaatg
ggcaagagcatggaggacgccttaaagagcggggatgcacagattgccttgcgtaagggg
cttgaccacccctttatcttgaatgggcaaaagactgctgctaaagttgtggctagcgat
ggcaaggtttccatgaagatgggcacgaacgcgccagcaatcgtcatttatacagccaac
agctttggcaagggggaaaagcaggtcaaggacctgccgcaatatggcggcttgaccttg
gaggcgcagaacgcgcctgcttcgggcaatgacttgcgggaaattcaccttgagccaggc
aagagctggcagcggcaggtgagctggaaattttaa

DBGET integrated database retrieval system