KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1656Help
Entry
LDBND_1656        CDS       T01360                                 

Definition
l-threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LDBND_1656
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LDBND_1656
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LDBND_1656
Enzymes [BR:lde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LDBND_1656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1703451..1704929
Genome map
AA seq 492 aa AA seqDB search
MIYRSTRSQGQEVTAVQAIVQGLSPDGGLFVPKEFPAPFSAAALKEIFALPYQDMAKKIL
ALFLTDYSAEQLAEIVKGAYGQQWDDDRIAPLTDKKAGNYYLELFHGPTLAFKDVALQCL
PRLMKTALENSDDHRGIVILTATSGDTGTAAMRGFQSLAKTRVIVFYPYQGVAPIQLKQM
LSENSDNTVAVAVEGNFDQAQTRVKQIFNDPDMNSLLADHDLTFSSANSMNVGRLLPQVI
YYFAAYKQLLDQEAIAFGDPVNFSVPTGNFGDILAGYYAQKLGLPVGRLICASNKNNVLT
DFFKTGKYDKKRDFYVTNSPSMDILVSSNLERLLFDLCQDPATVKSLMEQLNTKGEYQLP
EDMQKKLSSFWADYATPEEIEGEIKRVYEESGYVIDPHTAVASLAAKRFKEEDDKPTVVL
STASPYKFPETVYHAISGQNVKEKGLPALKELTDLTGPAPKAMEAFLGHSSREIVIPADN
MADEVKRQLDLD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccgcagtacccgcagccagggacaggaagttaccgctgtccaggcaatcgtc
caaggcctgtccccagatggcggccttttcgtgcctaaagaatttccggctccattttca
gccgctgctttaaaggaaatttttgccctgccttaccaggatatggctaaaaagatcctg
gccctcttcttgactgactacagtgcagagcaactggcagagattgttaaaggcgcctac
ggccagcaatgggatgacgaccggatcgccccgctgactgataagaaggccggcaattac
tacctggagctcttccacgggccaaccctggcctttaaggacgtggccttgcagtgcctg
ccccgcttgatgaagacagccttggaaaactcagacgaccacagggggatcgtgattttg
accgcgacttccggggacaccgggaccgccgccatgcggggtttccagtccttagccaaa
acccgggtcatcgtcttttacccttaccaaggggtggccccgatccagctcaagcagatg
ctgagcgaaaacagcgacaacaccgtggctgtagcggttgagggcaactttgaccaggcc
cagaccagggtcaagcagatttttaacgacccggacatgaacagtttgctggctgaccac
gatttgaccttctccagcgccaactccatgaatgttggccgcctcttgccccaggtcatc
tactacttcgccgcctacaagcagctgctggaccaagaagccattgccttcggcgatccc
gtcaatttctctgtgccaactggcaatttcggcgacattctggccggctattatgctcaa
aaactgggcctgccagtcggccgcctgatctgcgcttccaacaagaacaatgtcttaacc
gactttttcaagacgggcaagtatgacaagaagcgggacttctacgtgaccaactcccca
tccatggacatcctggtctccagcaacctggagcgcctgctctttgacctctgccaggac
ccggccacagtcaagtctttgatggagcagctgaatacaaagggcgaataccaattgcca
gaagacatgcaaaagaagctttccagcttctgggccgactacgccactccagaagaaatc
gaaggcgaaatcaagcgggtttacgaagagagcggctatgtcatcgacccgcacacggct
gttgcttctttagccgccaagcgctttaaggaagaagacgataaaccaactgtcgtcctc
tctactgccagcccttacaagttcccggaaaccgtctaccacgccatcagcgggcaaaat
gttaaagaaaaaggcctgccagcccttaaggaactgactgacctaactggccccgcccca
aaagccatggaggccttcttaggccacagctcccgggaaatcgtcatcccggctgataac
atggcagacgaagtcaagcggcagctggatctggactga

DBGET integrated database retrieval system