KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1662Help
Entry
LDBND_1662        CDS       T01360                                 

Gene name
pfk2
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LDBND_1662 (pfk2)
   01230 Biosynthesis of amino acids
    LDBND_1662 (pfk2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBND_1662 (pfk2)
   00030 Pentose phosphate pathway
    LDBND_1662 (pfk2)
   00051 Fructose and mannose metabolism
    LDBND_1662 (pfk2)
   00052 Galactose metabolism
    LDBND_1662 (pfk2)
  Energy metabolism
   00680 Methane metabolism
    LDBND_1662 (pfk2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LDBND_1662 (pfk2)
Enzymes [BR:lde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LDBND_1662 (pfk2)
Protein phosphatases and associated proteins [BR:lde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LDBND_1662 (pfk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1711477..1712556
Genome map
AA seq 359 aa AA seqDB search
MTLRVGILTSGGDCQALNATMRGLSKTLYNCVDDVEIIGFKRGYYGLMHEDYVKMKPRDF
SGIINEGGTILGTSRQPFKEMRVIVDGFDKVAAMKKTYKKLNLDALAVLGGNGSLKSANM
LAQEGLNVIGLPKTIDNDTWGTDYTFGFQSAVDIATRYLDEIHTTARSHSRVFVVEVMGH
KVGHITLAAGLAAGSEIILLPEIPYDINVVAKKVKKRQKSGKGFTVIAAAEGAISKEDAT
LPKKKYKAKVAARNGASVVKEIATQLQEVLPDAEIRTAVIGHAQRGGRPDAYDRQISTRF
GIEGARLIMNRSFGRLVVLKQGEVDSIALEDTAGKLKYVDPNGKAVSNARLMGVTFGDK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactttacgagttggtattttgacgagcggcggcgactgccaggcgctcaacgcgacc
atgcgggggctgtccaagaccctttacaactgtgtcgatgacgtggaaatcatcggtttc
aagcggggctactacggcttgatgcatgaagactacgtcaagatgaagccgcgggacttc
tccggcatcatcaacgaaggcgggacgattctgggcacttcccgccagccattcaaggaa
atgcgggtcatcgttgacggctttgacaaggtagctgccatgaagaagacctacaagaag
ctcaacctggacgctttggctgttttgggcggcaacgggtcacttaagtcagccaacatg
ctggcccaagaaggcttgaacgtgatcggcctgccaaagaccatcgacaacgacacttgg
ggaactgactacaccttcggtttccaaagcgctgttgatattgccaccagatacctggat
gaaatccacactactgctcgaagccactcccgggtcttcgtcgtcgaagtcatgggccac
aaggttggccacatcaccctagccgctggcctggctgccggcagcgaaattatccttttg
ccggaaattccttacgacatcaatgtcgtagccaagaaggtcaagaaaagacaaaagtct
ggcaagggcttcacggtcattgccgccgctgaaggggcaatttccaaggaagacgccacc
ctgcccaagaagaagtacaaggctaaggttgccgctagaaacggggccagcgtggttaaa
gaaatcgctacccaattgcaggaagttttgccagacgctgaaatcagaactgcggtcatc
ggccatgctcaacggggcggccggccagatgcctacgaccggcaaatctcaacccgcttc
gggattgaaggggcccgcctgatcatgaaccggtccttcggccgcctggttgtcttgaag
caaggtgaagtagattctatcgccctggaagacacggccggcaagctcaagtacgttgac
ccgaacggcaaggccgtaagcaacgcccgcctcatgggcgtcaccttcggggacaagtaa

DBGET integrated database retrieval system