KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1662Help
Entry
LDBND_1662        CDS       T01360                                 

Gene name
pfk2
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBND_1662 (pfk2)
   00030 Pentose phosphate pathway
    LDBND_1662 (pfk2)
   00051 Fructose and mannose metabolism
    LDBND_1662 (pfk2)
   00052 Galactose metabolism
    LDBND_1662 (pfk2)
  Energy metabolism
   00680 Methane metabolism
    LDBND_1662 (pfk2)
Enzymes [BR:lde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LDBND_1662 (pfk2)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     LDBND_1662 (pfk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1711477..1712556
Genome map
AA seq 359 aa AA seqDB search
MTLRVGILTSGGDCQALNATMRGLSKTLYNCVDDVEIIGFKRGYYGLMHEDYVKMKPRDF
SGIINEGGTILGTSRQPFKEMRVIVDGFDKVAAMKKTYKKLNLDALAVLGGNGSLKSANM
LAQEGLNVIGLPKTIDNDTWGTDYTFGFQSAVDIATRYLDEIHTTARSHSRVFVVEVMGH
KVGHITLAAGLAAGSEIILLPEIPYDINVVAKKVKKRQKSGKGFTVIAAAEGAISKEDAT
LPKKKYKAKVAARNGASVVKEIATQLQEVLPDAEIRTAVIGHAQRGGRPDAYDRQISTRF
GIEGARLIMNRSFGRLVVLKQGEVDSIALEDTAGKLKYVDPNGKAVSNARLMGVTFGDK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactttacgagttggtattttgacgagcggcggcgactgccaggcgctcaacgcgacc
atgcgggggctgtccaagaccctttacaactgtgtcgatgacgtggaaatcatcggtttc
aagcggggctactacggcttgatgcatgaagactacgtcaagatgaagccgcgggacttc
tccggcatcatcaacgaaggcgggacgattctgggcacttcccgccagccattcaaggaa
atgcgggtcatcgttgacggctttgacaaggtagctgccatgaagaagacctacaagaag
ctcaacctggacgctttggctgttttgggcggcaacgggtcacttaagtcagccaacatg
ctggcccaagaaggcttgaacgtgatcggcctgccaaagaccatcgacaacgacacttgg
ggaactgactacaccttcggtttccaaagcgctgttgatattgccaccagatacctggat
gaaatccacactactgctcgaagccactcccgggtcttcgtcgtcgaagtcatgggccac
aaggttggccacatcaccctagccgctggcctggctgccggcagcgaaattatccttttg
ccggaaattccttacgacatcaatgtcgtagccaagaaggtcaagaaaagacaaaagtct
ggcaagggcttcacggtcattgccgccgctgaaggggcaatttccaaggaagacgccacc
ctgcccaagaagaagtacaaggctaaggttgccgctagaaacggggccagcgtggttaaa
gaaatcgctacccaattgcaggaagttttgccagacgctgaaatcagaactgcggtcatc
ggccatgctcaacggggcggccggccagatgcctacgaccggcaaatctcaacccgcttc
gggattgaaggggcccgcctgatcatgaaccggtccttcggccgcctggttgtcttgaag
caaggtgaagtagattctatcgccctggaagacacggccggcaagctcaagtacgttgac
ccgaacggcaaggccgtaagcaacgcccgcctcatgggcgtcaccttcggggacaagtaa

DBGET integrated database retrieval system