KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1819Help
Entry
LDBND_1819        CDS       T01360                                 

Definition
dtdp-4-keto-6-deoxy-d-glucose 3,5-epimerase rmlc
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LDBND_1819
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LDBND_1819
Enzymes [BR:lde01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LDBND_1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1869813..1870421)
Genome map
AA seq 202 aa AA seqDB search
MGQIKVEKNVGGIEGLAVITPAVHGDDRGYFMETYNENDMKEAGFDINFVQDNQSSSTKG
VLRGLHFQKHFPQCKLVRAVRGDVFDVAVDLRSDSKTYGKWYGVELTAENKKQFLIPEGF
AHGFLVLSDVAEFCYKVNDFWHPNDEGGMAWNDPEIGIEWPKLVGEYPGSADASGYSLED
GTKLTLSDRDQKWAGLKDTFKF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaatcaaagttgaaaagaatgtcggcggtattgaaggtttggcagtgattacg
ccagcagttcacggggatgaccgtggctacttcatggaaacctacaacgaaaacgacatg
aaggaagctggttttgacatcaacttcgtccaagacaaccaatcaagctcaaccaagggc
gttttgcggggcctgcacttccaaaagcacttcccgcaatgcaagctggtccgggccgtg
cgcggggatgtcttcgatgttgctgttgacctgagaagcgactccaagacctacggcaag
tggtacggggtggaactgaccgctgaaaacaagaagcagttcttgattccagaaggtttc
gcccacggcttcctggttttgagcgacgtggctgaattctgctacaaggttaacgacttc
tggcacccaaacgatgaaggtggcatggcttggaacgaccctgaaatcgggattgaatgg
cctaagctggttggcgaatacccgggctcagctgatgctagcggctacagcttggaagac
ggcactaagctgaccttgtcagacagggaccaaaagtgggctggcttaaaggacaccttc
aagttctaa

DBGET integrated database retrieval system