KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1860Help
Entry
LDBND_1860        CDS       T01360                                 

Definition
lactate dehydrogenase related 2-hydroxyacid dehydrogenase
Orthology
K03778  
D-lactate dehydrogenase [EC:1.1.1.28]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Pyruvate metabolism
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lde00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1911442..1912488)
Genome map
AA seq 348 aa AA seqDB search
MRIACYGVRPLERSYFEKLNKYDYDLKLIPEYLNRENVVQAEDCDAVLVRGNCLCDRTNL
EQFKNYGISWVFTRSVGVDHFDLEAAKDLGISVARVPNYSPYAVANLAFTLGLTLSRHVG
EAAHHVHEQDFGMHPDYFATEFNRLKVGIYGAGKIGAVEGKMWQALGAEVYAYDPFPSDF
AKQYCTFVTEDELLATCDIVSVHVPYFPGENDKLMNAEFIAKMKEGAVLVNTARGELADE
AAIAAAVSSNHLSGYGADVVSNEKKIMGHKFDCESDVPDQEVQSLMDLYPRVLLTPHMGS
FTEPALEDMISLSFNNFHNMATEGAVDARNEVVAAPESSTFASEKLRA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgcatgttacggcgttaggccgcttgaaagaagttattttgaaaaactgaac
aagtatgactacgacttgaagctcattcctgaatacttgaaccgggaaaacgtagtacaa
gcagaagactgcgacgccgtcctggtccggggcaactgcctctgtgaccggaccaacctg
gagcagttcaagaactacgggatctcctgggtcttcacccggtcagtcggcgtggaccac
ttcgacctggaagccgctaaggacttgggcatctccgttgcccgggtgccaaactactcc
ccatacgcggtagccaacctggcctttaccctgggcttgactttgtcaagacacgttggt
gaagctgcccatcatgtccatgaacaggactttgggatgcatccggactacttcgctacg
gaattcaaccgcttgaaggtcggcatctacggggccggcaagatcggggcggttgaaggc
aagatgtggcaggctctgggcgctgaagtttatgcctatgacccattcccatctgacttc
gccaagcagtactgcacttttgtaacagaagacgaactgctggcaacttgtgacatcgtt
tccgttcacgtgccatacttcccaggcgagaacgacaagctgatgaacgctgaattcatc
gctaagatgaaggaaggggcagtcttggtcaacacggcccggggcgaactggctgatgaa
gcagccatcgccgctgctgtctccagtaaccacctgtctggctacggcgctgatgtggtt
tccaatgaaaagaagatcatgggccacaagtttgactgtgaaagcgacgtgccggaccag
gaagtccagtccttgatggacctttacccgcgggttctcttgactccgcacatgggctcc
tttactgaaccagccctggaagacatgatctccttgtcatttaacaatttccataacatg
gccactgagggggcagttgatgcccgcaatgaagtcgtggctgcaccggaaagctctact
ttcgcatctgagaagctgcgggcttaa

DBGET integrated database retrieval system