KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1862Help
Entry
LDBND_1862        CDS       T01360                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LDBND_1862
Enzymes [BR:lde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LDBND_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1913382..1913924)
Genome map
AA seq 180 aa AA seqDB search
MAKKIILIAGPSGAGKTTISEYLTDRYQIPRVITHTTRPKRPGESGTAYYFEDDDSFAQL
HFFEHVKYGDYQYGSSKEGLERAWAKNDLVSLIVDIKGARSYLEALGDQVYFLYVTCSLD
TLAQRMADRGDASDQIKKRLTGSELNELPEDLAKYAHVLVNDDLQATYASLDSLVRKLQN
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaaaaaattatcttgattgccggtcccagcggggcgggcaagacgactatatct
gaatatctgaccgaccgctaccagatcccccgggtgattacccataccacccggccaaag
cggcctggggaaagcgggacagcttattattttgaagacgatgattcttttgcccagctg
cacttctttgaacatgtcaaatacggggactaccagtacgggtccagtaaagaagggttg
gaaagagcctgggccaagaacgacctggtcagcttgatcgtggatatcaagggggcccgg
tcctacctggaagctttaggcgaccaggtttacttcctttatgtgacttgcagcctggat
accttggcgcaaagaatggctgaccggggtgatgcaagtgaccagatcaagaagcggctg
accggcagcgagttgaacgaattgccggaagatttggcaaaatacgcccatgtcctagtc
aatgacgacctgcaagcgacctatgccagcttggacagtttggtgagaaaattacaaaat
taa

DBGET integrated database retrieval system