KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1950Help
Entry
LDBND_1950        CDS       T01360                                 

Definition
glycerol kinase (ATP:glycerol 3-phosphotransferase) (glycerokinase) (gk)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lde00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LDBND_1950
Enzymes [BR:lde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LDBND_1950
Exosome [BR:lde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LDBND_1950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2003017..2004525)
Genome map
AA seq 502 aa AA seqDB search
MSEQYILAIDEGTTSTRAIIFNHAGQQVASVAREFTQYFPKPGWVEHHAEEIWNAVQITT
STALINSAIRPDQLAAIGITNQRETTVVWDKETGRPIYPAIVWQSRQTSDIAEKLVKDGY
SEMIRQKTGLVIDPYFSATKIRWILDHVEGAQERAEKGELLFGTIDTWLVWKLTRGKVHV
TDCTNASRTMLFNIHDLTWDQEILDLLKIPRAMLPEVKSNSEVYGETDPYQFFGGRVPIA
GMAGDQQAALFGQLAVKPGMVKNTYGTGSFIVMNTGEEPIESKNNLLTTIGYKLGDQVNY
ALEGSVFVAGSAIQWLRDSVKLLNSAPESEQAALESKDDNEVYVVPAFTGLGAPYWDSEA
RGAIFGLTRGSSDKDLIKATLQSLGYQTRDVVDTMQKDSGIEIPVLRVDGGASNNNYLLQ
FQADLLGKKIERAADLETTGLGAAFLAGLAVGYWQDLDSLKEIAKTGAAFAPKMEEAERD
RLYAGWQRAVLATRVFAHGKDF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaatacattttggcaatcgatgaggggactacctcaaccagggcaatcatt
ttcaaccatgccggccagcaggtggccagcgtggcccgggaattcacccagtacttcccc
aagcccggctgggtagagcaccatgctgaggaaatctggaacgcggtccagatcacgacg
tcaacggccctgatcaactccgccatccggccggaccaactggcggccatcgggattacc
aaccaaagagaaaccacggtggtctgggacaaggagacgggccggccaatctacccggcc
atcgtctggcagtcccggcaaactagcgatatcgcggaaaagctggttaaggacggctac
agcgagatgatccggcaaaagacgggcctggtgatcgacccttacttctccgccacgaag
atccgctggattttggaccatgtggaaggggcccaggaaagggcggaaaaaggggagctg
ctttttggcacgatcgacacctggctggtctggaagctgacccggggcaaggtccatgta
actgactgcaccaatgccagccggaccatgctctttaacattcatgatttgacctgggat
caggagatcctggacctgctgaagattccgcgggccatgctgccggaggttaaatcaaat
tctgaagtctacggggaaactgacccttaccagttcttcggcggcagagtgccgatcgcc
gggatggccggggaccagcaggcagccttgtttggccaattggccgtcaagccgggcatg
gtcaagaacacctacgggaccgggtctttcatcgtgatgaacacgggggaggaaccgatt
gaatccaagaataatttgctgacgactattggctacaagctgggcgatcaagtaaactat
gctttggaagggtcagtcttcgtggccgggtcagccatccagtggctgagagactcggtc
aagctgctgaactcagctccggaatcagagcaggcggccctggaatctaaagacgataat
gaagtctatgtggttcccgcctttactggtttgggggcaccatactgggacagtgaagcc
cggggggcgatttttggcttgaccagaggcagcagtgacaaggacttgatcaaggcaacc
ctgcagtccttgggctaccagacccgggatgtggtcgacaccatgcagaaggactcgggc
attgagattccggtcctcagagtcgacggcggggcttcaaacaacaactacctcctccag
ttccaggcagacctattaggcaagaagatcgagcgggcagcggatttggaaaccactggc
ctgggggccgcctttctggcaggtttagccgttggctactggcaagacctggatagcttg
aaggaaattgccaagaccggggccgcctttgcaccaaagatggaagaggcggaaagagac
cggctctacgcgggctggcagcgggcggttctggccacccgggtctttgcccacgggaaa
gatttttag

DBGET integrated database retrieval system