KEGG   Lactobacillus delbrueckii subsp. bulgaricus ND02: LDBND_1950Help
Entry
LDBND_1950        CDS       T01360                                 

Definition
glycerol kinase (ATP:glycerol 3-phosphotransferase) (glycerokinase) (gk)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lde  Lactobacillus delbrueckii subsp. bulgaricus ND02
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lde00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2003017..2004525)
Genome map
AA seq 502 aa AA seqDB search
MSEQYILAIDEGTTSTRAIIFNHAGQQVASVAREFTQYFPKPGWVEHHAEEIWNAVQITT
STALINSAIRPDQLAAIGITNQRETTVVWDKETGRPIYPAIVWQSRQTSDIAEKLVKDGY
SEMIRQKTGLVIDPYFSATKIRWILDHVEGAQERAEKGELLFGTIDTWLVWKLTRGKVHV
TDCTNASRTMLFNIHDLTWDQEILDLLKIPRAMLPEVKSNSEVYGETDPYQFFGGRVPIA
GMAGDQQAALFGQLAVKPGMVKNTYGTGSFIVMNTGEEPIESKNNLLTTIGYKLGDQVNY
ALEGSVFVAGSAIQWLRDSVKLLNSAPESEQAALESKDDNEVYVVPAFTGLGAPYWDSEA
RGAIFGLTRGSSDKDLIKATLQSLGYQTRDVVDTMQKDSGIEIPVLRVDGGASNNNYLLQ
FQADLLGKKIERAADLETTGLGAAFLAGLAVGYWQDLDSLKEIAKTGAAFAPKMEEAERD
RLYAGWQRAVLATRVFAHGKDF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaatacattttggcaatcgatgaggggactacctcaaccagggcaatcatt
ttcaaccatgccggccagcaggtggccagcgtggcccgggaattcacccagtacttcccc
aagcccggctgggtagagcaccatgctgaggaaatctggaacgcggtccagatcacgacg
tcaacggccctgatcaactccgccatccggccggaccaactggcggccatcgggattacc
aaccaaagagaaaccacggtggtctgggacaaggagacgggccggccaatctacccggcc
atcgtctggcagtcccggcaaactagcgatatcgcggaaaagctggttaaggacggctac
agcgagatgatccggcaaaagacgggcctggtgatcgacccttacttctccgccacgaag
atccgctggattttggaccatgtggaaggggcccaggaaagggcggaaaaaggggagctg
ctttttggcacgatcgacacctggctggtctggaagctgacccggggcaaggtccatgta
actgactgcaccaatgccagccggaccatgctctttaacattcatgatttgacctgggat
caggagatcctggacctgctgaagattccgcgggccatgctgccggaggttaaatcaaat
tctgaagtctacggggaaactgacccttaccagttcttcggcggcagagtgccgatcgcc
gggatggccggggaccagcaggcagccttgtttggccaattggccgtcaagccgggcatg
gtcaagaacacctacgggaccgggtctttcatcgtgatgaacacgggggaggaaccgatt
gaatccaagaataatttgctgacgactattggctacaagctgggcgatcaagtaaactat
gctttggaagggtcagtcttcgtggccgggtcagccatccagtggctgagagactcggtc
aagctgctgaactcagctccggaatcagagcaggcggccctggaatctaaagacgataat
gaagtctatgtggttcccgcctttactggtttgggggcaccatactgggacagtgaagcc
cggggggcgatttttggcttgaccagaggcagcagtgacaaggacttgatcaaggcaacc
ctgcagtccttgggctaccagacccgggatgtggtcgacaccatgcagaaggactcgggc
attgagattccggtcctcagagtcgacggcggggcttcaaacaacaactacctcctccag
ttccaggcagacctattaggcaagaagatcgagcgggcagcggatttggaaaccactggc
ctgggggccgcctttctggcaggtttagccgttggctactggcaagacctggatagcttg
aaggaaattgccaagaccggggccgcctttgcaccaaagatggaagaggcggaaagagac
cggctctacgcgggctggcagcgggcggttctggccacccgggtctttgcccacgggaaa
gatttttag

DBGET integrated database retrieval system