KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0083Help
Entry
LBU_0083          CDS       T01957                                 

Definition
(GenBank) Transcriptional regulators of NagC/XylR family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
ldl00010  Glycolysis / Gluconeogenesis
ldl00052  Galactose metabolism
ldl00500  Starch and sucrose metabolism
ldl00520  Amino sugar and nucleotide sugar metabolism
ldl00521  Streptomycin biosynthesis
ldl01100  Metabolic pathways
ldl01110  Biosynthesis of secondary metabolites
ldl01120  Microbial metabolism in diverse environments
ldl01130  Biosynthesis of antibiotics
ldl01200  Carbon metabolism
Module
ldl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ldl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBU_0083
   00052 Galactose metabolism
    LBU_0083
   00500 Starch and sucrose metabolism
    LBU_0083
   00520 Amino sugar and nucleotide sugar metabolism
    LBU_0083
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LBU_0083
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LBU_0083
Enzymes [BR:ldl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LBU_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N Kelch_1
Motif
Other DBs
NCBI-ProteinID: ADY84268
UniProt: F0JYK3
Position
89525..90463
Genome map
AA seq 312 aa AA seqDB search
MKKYAFGVDIGGTTVKIGLFETNGELSQKWEIPTRKEGNGSKILPDIAASLNDKLKELDI
PKEEVAGVGIDVPGPILDDEIVNRCVNLGWGVFNVAEKVRKLTGLDKVKVANDANAAALG
EMWQGGGESHQNVVMVTLGTGVGGGIISEGKIVAGAFGASGEIGHMLVNNDETQLCGCGK
KSHLEQYASATGIARKAKELLAESSEESSLRGVDQLDAKAVFDAAKEGDKLALEIVDFVG
ETLGTALASISCVFDPEVYVIGGGVSKAGQILLDTVQKHFVDAAFHASGGTEFALAQLGN
DAGMYGAVKMVL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaatatgcatttggtgttgacatcggtggtaccactgtaaagattggtttgttt
gaaaccaacggtgaattgtcccaaaagtgggaaatcccaactagaaaagaaggcaacggg
tccaagatcctgcctgatatcgctgcttctctgaacgacaagctgaaggaactggacatt
cctaaggaagaagtagccggggtcggcatcgacgtgccaggtccaatcctggacgacgaa
atcgttaaccgctgcgtcaacctgggttggggcgtcttcaacgtggctgaaaaggtccgc
aagctgactggcctggacaaagtcaaggtagccaacgacgccaacgctgctgctttgggt
gaaatgtggcaaggtggtggtgaaagccaccaaaacgttgtcatggttaccctaggtacc
ggtgtcggcggcgggatcatctctgaaggcaagatcgtcgctggtgcctttggggcttcc
ggggaaatcggccacatgctggtcaacaatgatgaaacccagctctgcggctgcggcaag
aagagccacctggaacaatacgcttccgctactggcattgcccgcaaggccaaggaactt
ctggctgaaagcagcgaagaatcaagcctgcgcggggtagaccagcttgacgccaaggca
gtctttgacgcggctaaggaaggcgacaagctggctctggaaatcgtcgactttgtcggc
gaaactttgggcactgccctggcttccatctcctgcgtctttgacccagaagtctacgtt
atcggcggcggggtctccaaggctggccaaatcttgctcgacactgtgcaaaagcacttc
gttgacgcggccttccacgcttctggaggtactgaattcgccctggctcaactgggcaac
gatgccggtatgtacggtgccgttaagatggttctgtaa

DBGET integrated database retrieval system