KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0163Help
Entry
LBU_0163          CDS       T01957                                 

Definition
(RefSeq) Asn synthetase
  KO
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LBU_0163
Enzymes [BR:ldl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LBU_0163
Peptidases [BR:ldl01002]
 Cysteine Peptidases
  Family C44
   LBU_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
169503..171452
Genome map
AA seq 649 aa AA seqDB search
MCGIVAFYDPEINDKQAAIGKMMATIQHRGPNSDGMYTNDKVALGFRRLSIIDLRGGSQP
IYNEDRSRAIIFNGEIYNFKPLREELIKAGHTFSTKADTEVILHGYEEWGMDGILKRVRG
MFAFIIWDDNTQTMYGARDFFGIKPMYYQDVDGHLLVGSELKSFLAFPHFKKELNTEAVK
PYLMNQYNDLKETFFKGVYRFQPGHWFEYKDGKMKTHQYWDAEYKDNNLSFEETVKKINE
DLKETVDLYRNADVKVGAFLSEGVDSSFLTALLDPDEVFSIGFDDNTYDEASKAKALADI
NGWHFYADKVYSEEAMRDFPEMQYHMDEPDANPSIIPLWYLCKLARKHVTVALSGEGADE
LFAGYVNYGMHTHNNVIKVFTDKLKKLPKGKRVKLAHKIKKMPNFPGKVHLYTNLAEPSE
FYVGQSVIYDMDYPTIFTSKDANAVLQPSYRNKLTVNGNYQEDFKKVKDLDNVKQMQYID
LHHFMLNDIEQKADKISMAHSLELRVPYLDVKIAKLANSIPSKYLVNKYDTKYALRKASE
QVLPDEWAKRPKLGFPTPIKQWLQEERFYKQVRDLFSEDFVNDIFEQKKILDLLDENYNG
DGSHRRQIWVIYTFLVWYKLFFVDYEETVRKYQRVQPEVASLIAQGKLL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtcgccttttacgatccagaaatcaatgacaagcaggcggccatcggc
aagatgatggctaccatccaacaccggggaccaaacagtgacgggatgtacaccaacgac
aaggtggcccttggtttcagaagactgtcgattatcgacctgcggggcggtagtcagcca
atctacaacgaagaccgcagccgggcgatcattttcaacggggaaatctacaacttcaag
cccttaagagaggaactgatcaaggcgggccacaccttctccaccaaggccgacactgaa
gtcatcctgcacggctatgaagaatgggggatggacgggatccttaagcgggtccggggg
atgttcgccttcatcatctgggacgacaatacccagaccatgtacggggcccgggacttc
ttcggtatcaagcctatgtactaccaggacgtggacggtcaccttttggtcggctcagaa
ttgaagagctttttggcctttcctcattttaaaaaggaactgaataccgaagccgtcaag
ccatacctaatgaaccagtacaacgaccttaaggaaaccttcttcaagggcgtctaccgc
ttccagccaggtcactggtttgaatacaaggacggcaagatgaagacgcaccagtactgg
gatgccgaatacaaggacaacaacctttcctttgaagaaacagtcaagaagatcaacgaa
gacttgaaggaaacggttgacctttaccgcaacgccgacgttaaggtcggggccttcctt
agtgaaggggttgactccagcttcctgacggcccttttggacccggatgaagtcttctcc
atcggctttgacgacaacacctacgatgaagcttccaaggccaaggccctggccgacatc
aacggctggcacttctacgctgacaaggtctactcagaagaagctatgcgggacttcccg
gaaatgcagtaccacatggacgaaccagacgccaacccgtcaatcattcctttgtggtac
ctgtgcaaattggccagaaagcacgtgactgttgccctgtccggggaaggggccgatgag
ctttttgccggctatgtcaactacgggatgcacacccacaacaatgtcatcaaggtcttt
accgacaagctgaagaagctgccaaagggcaagcgggttaagctggctcataagatcaag
aagatgccaaacttcccgggcaaggtgcacctttacaccaacttggctgaaccaagcgaa
ttctacgtgggccagtcagtcatctacgacatggattacccgaccatcttcacttccaag
gacgctaacgctgtcttgcagccgagctaccggaacaagctgacggttaacggcaactac
caggaagacttcaagaaggtcaaggacctggacaatgtcaagcagatgcagtacatcgac
ctgcaccactttatgctcaacgacatcgagcagaaggctgacaagatttccatggcccac
tccctggaactccgggtgccttacctggacgtgaagatcgccaaactggccaactctatt
ccaagcaagtacctggtcaacaaatacgacaccaagtacgccctgcgcaaggcttcagaa
caggtcctgccggatgaatgggccaagcggccgaagctgggcttcccgacgccaattaag
caatggctgcaggaagagcgtttctacaagcaggtcagagacctcttcagcgaagacttc
gtcaatgatatttttgaacaaaagaagatcctggacctgctggatgagaactacaatggg
gacggttctcaccgccgacagatctgggtaatctataccttcctggtttggtacaagctc
ttcttcgttgactacgaggaaaccgtgcgcaagtaccagcgcgtgcagccggaagtggcc
agcttgatcgcccagggcaagctgctctaa

DBGET integrated database retrieval system