KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0163Help
Entry
LBU_0163          CDS       T01957                                 

Definition
Asn synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ldl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
169503..171452
Genome map
AA seq 649 aa AA seqDB search
MCGIVAFYDPEINDKQAAIGKMMATIQHRGPNSDGMYTNDKVALGFRRLSIIDLRGGSQP
IYNEDRSRAIIFNGEIYNFKPLREELIKAGHTFSTKADTEVILHGYEEWGMDGILKRVRG
MFAFIIWDDNTQTMYGARDFFGIKPMYYQDVDGHLLVGSELKSFLAFPHFKKELNTEAVK
PYLMNQYNDLKETFFKGVYRFQPGHWFEYKDGKMKTHQYWDAEYKDNNLSFEETVKKINE
DLKETVDLYRNADVKVGAFLSEGVDSSFLTALLDPDEVFSIGFDDNTYDEASKAKALADI
NGWHFYADKVYSEEAMRDFPEMQYHMDEPDANPSIIPLWYLCKLARKHVTVALSGEGADE
LFAGYVNYGMHTHNNVIKVFTDKLKKLPKGKRVKLAHKIKKMPNFPGKVHLYTNLAEPSE
FYVGQSVIYDMDYPTIFTSKDANAVLQPSYRNKLTVNGNYQEDFKKVKDLDNVKQMQYID
LHHFMLNDIEQKADKISMAHSLELRVPYLDVKIAKLANSIPSKYLVNKYDTKYALRKASE
QVLPDEWAKRPKLGFPTPIKQWLQEERFYKQVRDLFSEDFVNDIFEQKKILDLLDENYNG
DGSHRRQIWVIYTFLVWYKLFFVDYEETVRKYQRVQPEVASLIAQGKLL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtcgccttttacgatccagaaatcaatgacaagcaggcggccatcggc
aagatgatggctaccatccaacaccggggaccaaacagtgacgggatgtacaccaacgac
aaggtggcccttggtttcagaagactgtcgattatcgacctgcggggcggtagtcagcca
atctacaacgaagaccgcagccgggcgatcattttcaacggggaaatctacaacttcaag
cccttaagagaggaactgatcaaggcgggccacaccttctccaccaaggccgacactgaa
gtcatcctgcacggctatgaagaatgggggatggacgggatccttaagcgggtccggggg
atgttcgccttcatcatctgggacgacaatacccagaccatgtacggggcccgggacttc
ttcggtatcaagcctatgtactaccaggacgtggacggtcaccttttggtcggctcagaa
ttgaagagctttttggcctttcctcattttaaaaaggaactgaataccgaagccgtcaag
ccatacctaatgaaccagtacaacgaccttaaggaaaccttcttcaagggcgtctaccgc
ttccagccaggtcactggtttgaatacaaggacggcaagatgaagacgcaccagtactgg
gatgccgaatacaaggacaacaacctttcctttgaagaaacagtcaagaagatcaacgaa
gacttgaaggaaacggttgacctttaccgcaacgccgacgttaaggtcggggccttcctt
agtgaaggggttgactccagcttcctgacggcccttttggacccggatgaagtcttctcc
atcggctttgacgacaacacctacgatgaagcttccaaggccaaggccctggccgacatc
aacggctggcacttctacgctgacaaggtctactcagaagaagctatgcgggacttcccg
gaaatgcagtaccacatggacgaaccagacgccaacccgtcaatcattcctttgtggtac
ctgtgcaaattggccagaaagcacgtgactgttgccctgtccggggaaggggccgatgag
ctttttgccggctatgtcaactacgggatgcacacccacaacaatgtcatcaaggtcttt
accgacaagctgaagaagctgccaaagggcaagcgggttaagctggctcataagatcaag
aagatgccaaacttcccgggcaaggtgcacctttacaccaacttggctgaaccaagcgaa
ttctacgtgggccagtcagtcatctacgacatggattacccgaccatcttcacttccaag
gacgctaacgctgtcttgcagccgagctaccggaacaagctgacggttaacggcaactac
caggaagacttcaagaaggtcaaggacctggacaatgtcaagcagatgcagtacatcgac
ctgcaccactttatgctcaacgacatcgagcagaaggctgacaagatttccatggcccac
tccctggaactccgggtgccttacctggacgtgaagatcgccaaactggccaactctatt
ccaagcaagtacctggtcaacaaatacgacaccaagtacgccctgcgcaaggcttcagaa
caggtcctgccggatgaatgggccaagcggccgaagctgggcttcccgacgccaattaag
caatggctgcaggaagagcgtttctacaagcaggtcagagacctcttcagcgaagacttc
gtcaatgatatttttgaacaaaagaagatcctggacctgctggatgagaactacaatggg
gacggttctcaccgccgacagatctgggtaatctataccttcctggtttggtacaagctc
ttcttcgttgactacgaggaaaccgtgcgcaagtaccagcgcgtgcagccggaagtggcc
agcttgatcgcccagggcaagctgctctaa

DBGET integrated database retrieval system