KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0185Help
Entry
LBU_0185          CDS       T01957                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBU_0185
   01230 Biosynthesis of amino acids
    LBU_0185
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBU_0185
  Energy metabolism
   00680 Methane metabolism
    LBU_0185
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBU_0185
Enzymes [BR:ldl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBU_0185
Exosome [BR:ldl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBU_0185
  Exosomal proteins of melanoma cells
   LBU_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
192246..192935
Genome map
AA seq 229 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSDKGVEEAKKAGRLIKEAGLEFDQAYTSVLTR
AIKTLHFALEESGQLWVPETKSWRLNERHYGALQGLNKAETAEKYGDEQVHIWRRSYDVL
PPVLADDSEFSQANDRRYANLDPHIVPKAENLKVTLDRVMPFWEDHIAPDLLAGKNVIIA
AHGNSLRALTKYIENISDEDIMDVEMKTGEPVVYTFDDKLNVVSKEKLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattagttttaatccgtcacggtcaaagtgaatggaacctttcaaaccaattc
actggttgggttgacgttaacttgtcagacaagggtgttgaagaagctaagaaggctggt
cgtttgatcaaggaagccggcttggaatttgaccaagcttacacttcagttttgacccgt
gcgatcaagactttgcactttgctttggaagaaagcggccaactctgggttccagaaact
aagtcctggagactgaacgaacgtcactacggcgctttgcaaggcttgaacaaggctgaa
actgctgaaaagtacggcgacgaacaagttcacatttggcgtcgttcatacgacgttttg
ccaccagttttggctgacgactcagaattcagccaagctaacgaccgtcgttacgcaaac
ttggacccacacatcgttcctaaggcagaaaacttgaaggttactctggacagagttatg
ccattctgggaagaccacattgctccagaccttttggctggcaagaacgtgatcatcgct
gctcatggtaactcactgcgtgccttgactaagtacatcgaaaacatctctgacgaagac
atcatggatgttgaaatgaagactggtgaaccagtcgtttacactttcgacgacaagttg
aacgttgtaagcaaggaaaagctggactaa

DBGET integrated database retrieval system