KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0185Help
Entry
LBU_0185          CDS       T01957                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
ldl00010  Glycolysis / Gluconeogenesis
ldl00260  Glycine, serine and threonine metabolism
ldl00680  Methane metabolism
ldl01100  Metabolic pathways
ldl01110  Biosynthesis of secondary metabolites
ldl01120  Microbial metabolism in diverse environments
ldl01130  Biosynthesis of antibiotics
ldl01200  Carbon metabolism
ldl01230  Biosynthesis of amino acids
Module
ldl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ldl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBU_0185
  Energy metabolism
   00680 Methane metabolism
    LBU_0185
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBU_0185
Enzymes [BR:ldl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBU_0185
Membrane trafficking [BR:ldl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LBU_0185
Exosome [BR:ldl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBU_0185
  Exosomal proteins of melanoma cells
   LBU_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ADY84370
UniProt: F0JZ30
Position
192246..192935
Genome map
AA seq 229 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSDKGVEEAKKAGRLIKEAGLEFDQAYTSVLTR
AIKTLHFALEESGQLWVPETKSWRLNERHYGALQGLNKAETAEKYGDEQVHIWRRSYDVL
PPVLADDSEFSQANDRRYANLDPHIVPKAENLKVTLDRVMPFWEDHIAPDLLAGKNVIIA
AHGNSLRALTKYIENISDEDIMDVEMKTGEPVVYTFDDKLNVVSKEKLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattagttttaatccgtcacggtcaaagtgaatggaacctttcaaaccaattc
actggttgggttgacgttaacttgtcagacaagggtgttgaagaagctaagaaggctggt
cgtttgatcaaggaagccggcttggaatttgaccaagcttacacttcagttttgacccgt
gcgatcaagactttgcactttgctttggaagaaagcggccaactctgggttccagaaact
aagtcctggagactgaacgaacgtcactacggcgctttgcaaggcttgaacaaggctgaa
actgctgaaaagtacggcgacgaacaagttcacatttggcgtcgttcatacgacgttttg
ccaccagttttggctgacgactcagaattcagccaagctaacgaccgtcgttacgcaaac
ttggacccacacatcgttcctaaggcagaaaacttgaaggttactctggacagagttatg
ccattctgggaagaccacattgctccagaccttttggctggcaagaacgtgatcatcgct
gctcatggtaactcactgcgtgccttgactaagtacatcgaaaacatctctgacgaagac
atcatggatgttgaaatgaagactggtgaaccagtcgtttacactttcgacgacaagttg
aacgttgtaagcaaggaaaagctggactaa

DBGET integrated database retrieval system