KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0185Help
Entry
LBU_0185          CDS       T01957                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBU_0185
   01230 Biosynthesis of amino acids
    LBU_0185
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBU_0185
  Energy metabolism
   00680 Methane metabolism
    LBU_0185
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBU_0185
Enzymes [BR:ldl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBU_0185
Exosome [BR:ldl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBU_0185
  Exosomal proteins of melanoma cells
   LBU_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
192246..192935
Genome map
AA seq 229 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSDKGVEEAKKAGRLIKEAGLEFDQAYTSVLTR
AIKTLHFALEESGQLWVPETKSWRLNERHYGALQGLNKAETAEKYGDEQVHIWRRSYDVL
PPVLADDSEFSQANDRRYANLDPHIVPKAENLKVTLDRVMPFWEDHIAPDLLAGKNVIIA
AHGNSLRALTKYIENISDEDIMDVEMKTGEPVVYTFDDKLNVVSKEKLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattagttttaatccgtcacggtcaaagtgaatggaacctttcaaaccaattc
actggttgggttgacgttaacttgtcagacaagggtgttgaagaagctaagaaggctggt
cgtttgatcaaggaagccggcttggaatttgaccaagcttacacttcagttttgacccgt
gcgatcaagactttgcactttgctttggaagaaagcggccaactctgggttccagaaact
aagtcctggagactgaacgaacgtcactacggcgctttgcaaggcttgaacaaggctgaa
actgctgaaaagtacggcgacgaacaagttcacatttggcgtcgttcatacgacgttttg
ccaccagttttggctgacgactcagaattcagccaagctaacgaccgtcgttacgcaaac
ttggacccacacatcgttcctaaggcagaaaacttgaaggttactctggacagagttatg
ccattctgggaagaccacattgctccagaccttttggctggcaagaacgtgatcatcgct
gctcatggtaactcactgcgtgccttgactaagtacatcgaaaacatctctgacgaagac
atcatggatgttgaaatgaagactggtgaaccagtcgtttacactttcgacgacaagttg
aacgttgtaagcaaggaaaagctggactaa

DBGET integrated database retrieval system