KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0195Help
Entry
LBU_0195          CDS       T01957                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LBU_0195
Enzymes [BR:ldl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LBU_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203917..205008
Genome map
AA seq 363 aa AA seqDB search
MEIKKINNRQQTFSGNVTISFNANTEELPKLINLLADQTANLSISSSLVIATFTQTELAA
VIKSWPEVFGAESGTLQQIQAASQIHFKGRGFDFDITTKPIIYSILNLTPDSFYDGGRNA
SVDGVLKRIEADLAAGTAIFEVGGKSSKPHFDDISAEEEWGRIKPFLDAIHKRFPNIVLA
IDSNTNAVIEEALKNGIQIINDIDGFNSQAKLNLVAKYKPAVVTMFNGRNFNEQTETLSK
TMMDFFTHTISDLTGVGLEKENIVIDPGVGFSDHNTLAFDLIKMKLTKLMAEFQTPIMIA
ISRKSFAKRLFNLESADDRLIPTLLFEAFMTVLGGRVIRVHDAKETRQLIDAFELLKDQL
LLK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaaaataaacaatcgtcaacaaacatttagcggcaacgtcaccatttct
tttaatgcgaatacagaagaattacccaaattaattaatctgttagctgaccagactgcc
aatctttcgatttcgtcatcgctagtcatcgcgacatttacgcaaacggaattggcagct
gtaattaaaagttggccagaagtgtttggcgctgaaagcggtacgctgcagcaaatccag
gcagcttctcaaatccattttaagggtcggggatttgactttgatattacgaccaaacca
attatttattcgattttaaacttgacgccggattcattttacgatggtgggagaaacgct
tcagtcgatggggttctgaaacgaattgaagcagacctggcagccggaactgccatcttt
gaagtcggtggcaaatcttccaagccacactttgatgatattagtgctgaagaggagtgg
gggcgaattaaaccgtttttggacgctattcacaagcgttttccaaatattgttttggca
attgattccaatacaaacgcggttattgaagaagcactaaaaaatggtattcaaattatt
aacgacatcgatggctttaattctcaagcaaaactgaatttagttgctaaatacaaacct
gctgttgtaacgatgtttaatggtcggaacttcaatgagcaaacggaaaccttatcaaaa
acaatgatggatttctttacacatacaattagcgatttaacaggcgttgggcttgaaaaa
gaaaacattgtgattgacccgggcgttggcttttctgatcataatacgttagcttttgat
ctgattaagatgaaattaacgaaattaatggcagaatttcaaacaccgattatgattgca
atttcgcgaaaaagttttgctaaacggctgtttaatttggaatcagcggatgatcgattg
attccaacgctgctatttgaagcatttatgacggttcttggcggtcgggttattcgggta
catgatgcaaaagaaactcgtcagctaatcgatgcttttgagttgctaaaagatcagcta
ttgctaaagtaa

DBGET integrated database retrieval system