KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0195Help
Entry
LBU_0195          CDS       T01957                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ldl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203917..205008
Genome map
AA seq 363 aa AA seqDB search
MEIKKINNRQQTFSGNVTISFNANTEELPKLINLLADQTANLSISSSLVIATFTQTELAA
VIKSWPEVFGAESGTLQQIQAASQIHFKGRGFDFDITTKPIIYSILNLTPDSFYDGGRNA
SVDGVLKRIEADLAAGTAIFEVGGKSSKPHFDDISAEEEWGRIKPFLDAIHKRFPNIVLA
IDSNTNAVIEEALKNGIQIINDIDGFNSQAKLNLVAKYKPAVVTMFNGRNFNEQTETLSK
TMMDFFTHTISDLTGVGLEKENIVIDPGVGFSDHNTLAFDLIKMKLTKLMAEFQTPIMIA
ISRKSFAKRLFNLESADDRLIPTLLFEAFMTVLGGRVIRVHDAKETRQLIDAFELLKDQL
LLK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaaaataaacaatcgtcaacaaacatttagcggcaacgtcaccatttct
tttaatgcgaatacagaagaattacccaaattaattaatctgttagctgaccagactgcc
aatctttcgatttcgtcatcgctagtcatcgcgacatttacgcaaacggaattggcagct
gtaattaaaagttggccagaagtgtttggcgctgaaagcggtacgctgcagcaaatccag
gcagcttctcaaatccattttaagggtcggggatttgactttgatattacgaccaaacca
attatttattcgattttaaacttgacgccggattcattttacgatggtgggagaaacgct
tcagtcgatggggttctgaaacgaattgaagcagacctggcagccggaactgccatcttt
gaagtcggtggcaaatcttccaagccacactttgatgatattagtgctgaagaggagtgg
gggcgaattaaaccgtttttggacgctattcacaagcgttttccaaatattgttttggca
attgattccaatacaaacgcggttattgaagaagcactaaaaaatggtattcaaattatt
aacgacatcgatggctttaattctcaagcaaaactgaatttagttgctaaatacaaacct
gctgttgtaacgatgtttaatggtcggaacttcaatgagcaaacggaaaccttatcaaaa
acaatgatggatttctttacacatacaattagcgatttaacaggcgttgggcttgaaaaa
gaaaacattgtgattgacccgggcgttggcttttctgatcataatacgttagcttttgat
ctgattaagatgaaattaacgaaattaatggcagaatttcaaacaccgattatgattgca
atttcgcgaaaaagttttgctaaacggctgtttaatttggaatcagcggatgatcgattg
attccaacgctgctatttgaagcatttatgacggttcttggcggtcgggttattcgggta
catgatgcaaaagaaactcgtcagctaatcgatgcttttgagttgctaaaagatcagcta
ttgctaaagtaa

DBGET integrated database retrieval system