KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0237Help
Entry
LBU_0237          CDS       T01957                                 

Definition
Phospho-beta-galactosidase II
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ldl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
247889..249280
Genome map
AA seq 463 aa AA seqDB search
MTDITTAGSLESPRYLTYTLDGKDGKVAGMFASSLPKGAKGKIFDNEYYPNHVAIDFYHH
YKEEIKMFADMGFKVFRTSIAWTRIFPTGEEDKPNQEGLDFYRRVFEELKKNGIEPLVTI
SHYEDPLALGEKYNDWQDRKMIDLYVKYATTLFKEYKDLVKYWLTFNEINSSLMFLKLVG
DGKVSDADYQKAYQKLHHQFVASAKAVVAGHKINPDFMIGNMIAGSVYYPGTPDPKDALA
ARYEEELSQLYCADAQAKGEYPSFAKRLWDEHNVHLKIEDGDLEVMKEGKVDMYTFSYYM
SNMVTTHDVGEKAKGNFAAGAKNPYLEYSEWGWSTDPDGLQLYLEKMYDRYGIPMMVVEN
GLGAVDKLEDGTVHDDYRIDYLRKHIKAMDKAVEHGVDLRAYTTWGCMTAFLPELVKCPS
GMASYTLTVMTRAKVRLSACLRIHTTGTKRLSLQTAMNYKIKA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacattaccacggccggctctttggaaagtccgcgttacctgacttacactttg
gatggcaaggatggcaaagtagctgggatgttcgccagctccttgccaaagggcgctaag
gggaagatttttgacaatgaatactacccgaaccatgtagcgatcgatttttaccatcac
tacaaggaagaaatcaagatgttcgcggacatgggctttaaggtattcagaacttccatt
gcctggacgcggattttcccaaccggtgaagaagacaagccaaaccaggaagggctggac
ttctaccgcagagtctttgaagaactgaagaagaacgggattgaaccattagttacgatt
tcccactatgaagacccattggctttaggcgaaaagtacaacgactggcaagaccgcaag
atgattgacctctacgttaagtacgcgacgaccttgttcaaggaatacaaggacctggtt
aaatactggctgaccttcaacgaaatcaactcatccttgatgttcttgaagctggtgggt
gatggcaaggtatctgatgcagattaccaaaaggcttaccaaaagctgcaccaccaattc
gttgcttctgctaaggcagttgttgcaggccacaagatcaacccagacttcatgatcggg
aacatgattgccggttctgtttactacccaggcactcctgatccaaaggatgctttggct
gcccgctatgaagaagaattgagccagctttactgtgctgacgcgcaagctaagggtgag
tatccaagttttgccaagcgcttatgggatgaacacaatgttcatttgaagattgaagat
ggcgaccttgaagtcatgaaggaaggtaaagttgacatgtacaccttctcatactacatg
tcaaacatggttaccacccatgatgttggcgaaaaggctaagggcaacttcgctgccggc
gctaagaacccatatcttgaatactctgaatggggatggtcaactgacccagacggcttg
caactgtacttggaaaagatgtatgaccgttatggcatcccaatgatggtggtggaaaat
ggtcttggtgccgttgataagctagaagatggtactgttcatgacgattaccggattgac
tacttgagaaagcacatcaaggcgatggacaaggcagttgaacatggggttgacctgcgt
gcctacacgacttggggttgcatgactgcgtttctgccggaactggtcaaatgtccaagc
ggtatggcttcatatacgttgaccgtgatgacaagggcgaaggtacgcttaagcgcctgc
ctaaggattcatactactggtaccaaaaggttatcgcttcaaacggcgatgaattataaa
attaaagcgtaa

DBGET integrated database retrieval system