KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0439Help
Entry
LBU_0439          CDS       T01957                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBU_0439
Enzymes [BR:ldl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LBU_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438366..439286
Genome map
AA seq 306 aa AA seqDB search
MQKIVVIGSSNVDTTLHVENFPKPGETINAHKVSEAGGGKGGNQAVAAAKSAAETIFISR
VGEDSYGSWMKEQLAGYGVKTDYVLPTAGVKTGHAYITLNAEGQNDIIIDHGANYSLTEA
DVLAAKDVIEAADCVIAQLETPLEATTAAFKLAKAAGKVTILNPAPAIKDLPADLLAVTD
LITPNETESALLTSLPVAEEADLEKNAAKLHELGVKHVIITYGSKGAYLSSPVFTGLVPA
FKVKAVDTTAAGDTFLGFLAGSLASDFSNLHEAARFANRASSLAVQKMGAQPSIPDRASV
ASALAE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagatcgtagtaatcgggtccagcaacgtggacacgacactgcatgtagaaaac
ttccccaagccaggcgaaaccatcaacgcccacaaggtcagcgaggctggcggcggcaag
gggggcaaccaggcagtcgcggctgctaagagcgcggctgagaccatcttcatctctaga
gtcggcgaagactcctatgggagctggatgaaagagcaactggccggctacggggtcaag
actgactatgtcttgccaaccgctggcgttaagactggccatgcctacattaccttgaac
gcggaagggcaaaacgacattatcatcgaccatggggccaactacagcttgactgaagcc
gacgttttggcggctaaagacgtcattgaagctgctgactgcgtcatcgcccagctggaa
accccgctggaagcaacaacagccgccttcaagctggctaaggcggccggcaaggtaact
atcttgaacccagctcccgcgatcaaggacctgccagctgaccttttggccgtaactgat
ttgatcacgccaaacgaaacggaaagtgccctgttgacttcactgccagttgcagaagag
gctgacctggaaaagaacgcggccaagctgcatgaactgggcgttaaacatgtgatcatc
acctacggcagcaagggggcctacctgtcttccccagtctttactggtcttgtaccagcc
tttaaggtcaaggcggtggacacgacggcggctggcgataccttcttaggctttttggcc
ggatccttggccagcgacttcagcaacctgcatgaggctgcccgctttgccaaccgggcg
tcgtctttagccgtgcagaagatgggggcccagccttctatcccggaccgggccagcgtt
gcgtctgctttagctgagtaa

DBGET integrated database retrieval system