KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0466Help
Entry
LBU_0466          CDS       T01957                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LBU_0466
   00052 Galactose metabolism
    LBU_0466
   00500 Starch and sucrose metabolism
    LBU_0466
   00520 Amino sugar and nucleotide sugar metabolism
    LBU_0466
Enzymes [BR:ldl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LBU_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
466238..467152
Genome map
AA seq 304 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAMASGIEDILIITGRNK
RAIEDHFDSNTELEDNLTEKHKDTLLKLARETTMSNIKVNLYFTRQPYPNGLGDAVNRAR
SFIAGEPFVVMLGDDLMRDKTPLTKQLIDCYDETHASTIAVMKVPHEEVNKYGVIDPIGE
TAPDLYNVKAFVEKPDVDKAPSDLAIIGRYLLTPEIFDMLDKQKAGAGGEIQLTDAIDAL
NKTQRVFAHEFKGQRFDVGNKEGYMETSIQYGLRHPETKDALRKYIIDLGKKLESEGKKK
PTGK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagaaaagcgatcatcccagctgccggtttgggaaccagatttttgccagca
accaaggccatgcctaaggaaatgctgccaatcgttgacaagccaactattcaatttatc
gttgaagaagccatggcttcagggattgaagacattctgatcattactggcagaaacaag
cgggcaatcgaagaccacttcgactcaaacacggaactagaagacaacttgactgaaaag
cacaaggacacgcttttgaagctggcccgggaaaccaccatgtccaacataaaggttaac
ctttacttcacccggcagccgtatccaaatggcttaggggatgccgtcaaccgggctcgc
agctttatcgccggtgaacctttcgtggttatgctaggcgacgacttgatgagagacaag
acgccattgaccaagcaattgatcgactgctacgatgaaactcacgcttcaaccatcgcg
gttatgaaggtaccgcatgaagaagtcaacaagtacggtgtcatcgacccaatcggcgaa
actgctccggacttgtacaacgttaaggcctttgtggaaaagccagacgttgacaaggct
ccaagtgacctggccatcatcggccgctacctgctgactccggaaatttttgacatgctg
gacaagcaaaaggccggtgccggcggtgaaatccaattgactgacgccatcgacgccttg
aacaagacccagcgggtcttcgcccacgaattcaagggccagcgttttgacgtcggcaac
aaggaaggctacatggaaacttccatccaatacggtctccgtcacccggaaaccaaggat
gctttgcgcaagtacatcattgacttgggcaagaagctggaaagcgaaggcaagaagaag
ccaaccggcaagtga

DBGET integrated database retrieval system