KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0534Help
Entry
LBU_0534          CDS       T01957                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBU_0534
   01230 Biosynthesis of amino acids
    LBU_0534
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBU_0534
   00051 Fructose and mannose metabolism
    LBU_0534
   00562 Inositol phosphate metabolism
    LBU_0534
Enzymes [BR:ldl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LBU_0534
Exosome [BR:ldl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LBU_0534
  Exosomal proteins of bladder cancer cells
   LBU_0534
  Exosomal proteins of melanoma cells
   LBU_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534888..535646
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLNMNPKETVEFVNAVKDQLPDPSKVESVICAPAVDLDALLKAAEGSNL
HVGAENCYWENSGAFTGETSPAVLKEMGVQYVIIGHSERRDYFHETDEDINKKAKAIFAN
GLTPILCCGESLETREAGKENEWVVSQIKAGLEGLTSEQVSKLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMAKPNIDGGLVGGASLV
PDSYLALVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaccccaattattgctggtaactggaagctgaacatgaacccaaaggaaact
gttgagttcgtaaacgctgttaaggaccaattgccagacccatcaaaggttgaatcagtg
atttgtgcaccagcagttgacttggacgccttgctgaaggctgccgaaggctcaaacctg
cacgtcggtgcagaaaactgctactgggaaaactccggtgccttcactggtgaaacttct
ccagcagttttgaaggaaatgggcgtgcaatacgtcatcatcggtcactcagaacgccgt
gactacttccacgaaactgacgaagacatcaacaagaaggccaaggctatctttgccaac
ggcttgactccaatcctttgctgcggtgaatcactggaaacccgggaagccggcaaggaa
aacgaatgggttgtcagccaaatcaaggctggcctggaaggcttgactagtgaacaagtt
tccaagctggtgatcgcttacgaaccaatctgggcgatcggcactggcaagactgcttca
agcgaccaagctgaagaaatgtgcaagactatccgggaaactgttaaggacttgtacaac
gaagaaactgctgaaaacgtccgcatccaatacggcggttcagtaaagccagccaacgtc
aaggaattgatggctaagccaaacatcgacggtggcttggttggtggtgcatcattggta
ccagactcatacctggctttggtaaactaccaagactaa

DBGET integrated database retrieval system