KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0534Help
Entry
LBU_0534          CDS       T01957                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
ldl00010  Glycolysis / Gluconeogenesis
ldl00051  Fructose and mannose metabolism
ldl01100  Metabolic pathways
ldl01110  Biosynthesis of secondary metabolites
ldl01120  Microbial metabolism in diverse environments
ldl01130  Biosynthesis of antibiotics
ldl01200  Carbon metabolism
ldl01230  Biosynthesis of amino acids
Module
ldl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ldl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBU_0534
   00051 Fructose and mannose metabolism
    LBU_0534
   00562 Inositol phosphate metabolism
    LBU_0534
Enzymes [BR:ldl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LBU_0534
Exosome [BR:ldl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LBU_0534
  Exosomal proteins of bladder cancer cells
   LBU_0534
  Exosomal proteins of melanoma cells
   LBU_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ADY84719
UniProt: F0K163
Position
534888..535646
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLNMNPKETVEFVNAVKDQLPDPSKVESVICAPAVDLDALLKAAEGSNL
HVGAENCYWENSGAFTGETSPAVLKEMGVQYVIIGHSERRDYFHETDEDINKKAKAIFAN
GLTPILCCGESLETREAGKENEWVVSQIKAGLEGLTSEQVSKLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMAKPNIDGGLVGGASLV
PDSYLALVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaccccaattattgctggtaactggaagctgaacatgaacccaaaggaaact
gttgagttcgtaaacgctgttaaggaccaattgccagacccatcaaaggttgaatcagtg
atttgtgcaccagcagttgacttggacgccttgctgaaggctgccgaaggctcaaacctg
cacgtcggtgcagaaaactgctactgggaaaactccggtgccttcactggtgaaacttct
ccagcagttttgaaggaaatgggcgtgcaatacgtcatcatcggtcactcagaacgccgt
gactacttccacgaaactgacgaagacatcaacaagaaggccaaggctatctttgccaac
ggcttgactccaatcctttgctgcggtgaatcactggaaacccgggaagccggcaaggaa
aacgaatgggttgtcagccaaatcaaggctggcctggaaggcttgactagtgaacaagtt
tccaagctggtgatcgcttacgaaccaatctgggcgatcggcactggcaagactgcttca
agcgaccaagctgaagaaatgtgcaagactatccgggaaactgttaaggacttgtacaac
gaagaaactgctgaaaacgtccgcatccaatacggcggttcagtaaagccagccaacgtc
aaggaattgatggctaagccaaacatcgacggtggcttggttggtggtgcatcattggta
ccagactcatacctggctttggtaaactaccaagactaa

DBGET integrated database retrieval system