KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0651Help
Entry
LBU_0651          CDS       T01957                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ldl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
639036..641426
Genome map
AA seq 796 aa AA seqDB search
MTEFSGEVKSVIYENAQNMYKILLVAVSQPLAGYDDDEIKVTGIFGDLELGQEYNFTGDL
VTHPKYGLQFQATGCQPALPKETGGVVKYLSSEKFPGIGPKTAEKIVDQLGSGGLKSLQA
DPTLIAKLDLSQKQKDSLLSGLAQMDSFDDLGMTLASYGIPRKVAGRLYQKYHDQTLKKL
QADPYLPLGEVTGYSFKQADHLGIGFGIALDSLERADGSILAVLLQALTMEGETYLELEE
LLPAAKELTNINFDRLAEAVNDLQDKKKVVVEEGRASLLAPFQVESEIVTDLEDLLAKGK
EADYREKDLDQAIKRAERKLGISYDPEQKQAIKNAVTSPVSILTGGPGSGKTTIIDGILL
VLKDLADMDEEEAEEAILLAAPTGRAAKRMEEVTGYPAKTIHRLLGLGIDNSEEMELNDL
EGEILIVDEMSMVDIYLFEKLLSAISNVHHLVFVGDKDQLPSVGAGKVFADLIEADFIPT
CQLQVVHRQKDDSTIIPLAHAVNEGANPAVLLQKTASYSFIPCRPHAVPSAVEQITQAAL
KSGFAADDIQVLGAMYRGDGGINSLNDTLQRVINPEKGNDKAVEAHGENFRLHDRVLQLQ
NDPERGIYNGEIGKVVAVDPEMLEDEDDEVKLLVNFDGNEVAYTQADLNNLTRAYAITIH
KSQGSEFPLVILCLTMQNYIMLKRNLLYTAITRASQKLVMVGEEQAFAQAMRVKGNERRT
NLVWLLKDRFKPEEQSKQESSDSTENTLDKEEKVEDYILTGARISRAEISPMVGMEGLVQ
GCKNLVEIVRTKGPGA
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtttagcggtgaagtaaagagcgttatttatgaaaatgcgcaaaacatgtac
aagatcttgctggtcgccgtaagtcagcctctggccggctatgacgatgatgaaatcaag
gtgacggggatcttcggggacctggagcttggccaggaatacaactttaccggtgacttg
gtcacccaccccaagtacggcttgcagtttcaagcgactggctgccagccggccctgccg
aaagagactggcggggtggtcaagtacctgtcttctgagaagttccctggcatcgggccc
aagacggcggaaaagatcgttgaccagctgggcagcgggggcttaaagagcttgcaggct
gatccaaccttgatcgccaagctggatctttcccaaaagcaaaaagacagcctcttgtcc
ggcctggcccagatggattcctttgacgacctgggtatgactttggccagttacgggatt
ccccgcaaggtggccggccgcctttaccagaagtaccatgaccagaccttgaaaaagctg
caggccgatccctacctgcctttaggcgaagtgaccggctattccttcaagcaggccgat
cacttgggaattggctttggaattgcccttgacagtctggagcgggctgatggcagtatc
ctggcggttttgctccaggccttgaccatggagggggaaacctacctggaactggaagaa
cttttgccagccgccaaggaactgacaaatataaattttgaccgcctggcagaagcagtt
aacgacctgcaggacaagaagaaggtcgtcgtggaagaaggccgggccagcctgctggcc
ccatttcaagtggaaagcgagatcgtgaccgacctggaagaccttttagccaagggcaag
gaagcggactaccgggaaaaggacttggaccaggccatcaagcgggccgaaaggaagctg
gggatcagctatgaccctgagcaaaagcaggccatcaaaaacgcggtaaccagtccggtc
tccatcctgactgggggacccgggagcgggaagacgaccatcattgacgggatcttgctg
gtcttaaaggacctggccgacatggacgaagaagaagctgaagaagcgattctcctggcc
gcgccaaccggccgggcagccaagcggatggaggaagtcaccggctatccggccaagacc
atccaccgcctcttgggcctggggatcgacaacagcgaggaaatggagctgaatgatttg
gaaggggagatcttgatcgtcgacgaaatgtccatggtcgacatctacctctttgaaaag
ctgctcagcgccatcagcaatgttcaccacctggtctttgtcggtgacaaggaccaattg
ccatccgtcggggcggggaaggttttcgctgacttaatcgaggcggacttcattccgacc
tgccagttgcaggtggtccaccggcaaaaggacgattcaacgatcattcccctggcccac
gcggtcaacgaaggagccaacccggctgttctcttgcaaaagacggccagctactccttt
attccttgccggccccatgccgtgcctagcgccgtcgagcagatcacccaggcagcctta
aagagtggctttgcggctgacgacatccaggttctgggggccatgtaccgaggcgacggt
gggatcaacagtctgaatgacaccctccagcgggtgatcaacccggaaaagggcaatgat
aaagcagttgaggcccatggtgagaactttcgcctgcatgaccgggtcctgcagctgcaa
aatgacccggagcgggggatctacaacggcgagattggaaaggtcgtggccgttgacccg
gaaatgctggaagacgaggatgacgaagtcaagcttttggtcaattttgacggcaatgaa
gtggcttacacgcaggcggacttgaataatctgacccgggcctatgccatcaccatccac
aagtcccaggggtcagaatttcctttggtcattctctgcttaaccatgcagaactatatc
atgctcaagcgcaatcttttgtatacggccatcacccgggcttcccagaagctggtcatg
gtcggagaagagcaggcttttgcccaggccatgcgggtcaagggcaatgagcggcggacc
aacctggtctggctcttgaaggaccgctttaagccagaagaacaaagtaagcaagagagt
agtgactctacagagaatactctggataaagaagaaaaagtcgaagactacatcttgacc
ggggcccggatcagccgggcggagatttctcccatggttggcatggagggcctggttcag
ggatgcaagaatttggtggaaatcgtccggaccaagggaccaggagcctaa

DBGET integrated database retrieval system