KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0712Help
Entry
LBU_0712          CDS       T01957                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBU_0712
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LBU_0712
Enzymes [BR:ldl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LBU_0712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(712657..713196)
Genome map
AA seq 179 aa AA seqDB search
MADKQAAAAVGQGLLIEEYTRSLLVQGMVSAQILLTQDDFADQRRYQNAQTALNVLLSRR
VIPIINENDTIAIDELKVGDNDTLSAQVASLLKADLLVLLTDVPGLYSDNPRKNPDARPI
PVINEIPPQIFAMAGGMATKIKAADMATKSGVVELEKNGFRYAAISAVNAALKRNQELG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacaagcaggctgcggccgctgtcggccaggggctcttgatcgaggaatacacc
cgcagccttttggtccagggcatggtttccgcccagatcctcctgacccaggacgacttc
gctgaccagcgccgctaccaaaatgcccagacggccttgaacgttcttttgagccggcgg
gtcatccccatcatcaacgaaaatgacaccatcgccatcgatgaactgaaagtcggtgac
aacgacaccctgtcagcccaggtagcctcccttttaaaggctgacctcctggtccttttg
acagatgtgcctggcctgtacagcgacaaccccagaaagaaccctgatgcccggccgatc
ccggtcatcaacgagattcccccgcaaatttttgcaatggccggcggcatggccaccaag
atcaaagccgctgacatggcgaccaagtccggcgtcgttgaactggagaagaatggtttc
cgctacgcggccatcagcgcagttaacgcggctcttaagcggaaccaggaattgggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system