KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_0716Help
Entry
LBU_0716          CDS       T01957                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBU_0716
   01230 Biosynthesis of amino acids
    LBU_0716
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBU_0716
   00030 Pentose phosphate pathway
    LBU_0716
   00051 Fructose and mannose metabolism
    LBU_0716
   00052 Galactose metabolism
    LBU_0716
  Energy metabolism
   00680 Methane metabolism
    LBU_0716
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LBU_0716
Enzymes [BR:ldl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LBU_0716
Protein phosphatases and associated proteins [BR:ldl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LBU_0716
Messenger RNA biogenesis [BR:ldl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LBU_0716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
719194..720153
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVTRVAIANGLEVFGIRYGFAGLVAGDIFPLESEDVAHL
INVSGTFLYSARYPEFAEEEGQLAGIEQLKKHGIDAVVVIGGDGSYHGALQLTRHGFNSI
GLPGTIDNDIPYTDATIGYDTACMTAMDAIDKIRDTASSHHRVFIVNVMGRNCGDIAMRV
GVACGADAIVIPERPYDVEEIANRLKQAQESGKDHGLVVVAEGVMTADQFMAELKKYGDF
DVRANVLGHMQRGGTPTVSDRVLASKLGSEAVHLLLEGKGGLAVGIENGKVTSHDILDLF
DESHRGDYDLLKLNADLSR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttgactagcggcggtgacgcccctggtatgaatgcagccgta
agagccgtaaccagagtcgcgatcgcgaacggtttggaagttttcggtatcagatacggt
tttgcaggtttggttgcgggcgacattttcccattggaaagtgaagacgtagcccacttg
atcaatgtttccggtaccttcctctactctgcgcgttatcctgaatttgcagaagaagaa
ggacagctggctggtattgaacaattgaagaagcacggcatcgatgctgttgtcgttatt
ggtggggatggttcctaccatggcgccctgcagctgacccgccacggcttcaactcaatt
ggcctgccaggcacgatcgacaacgatatcccttacacggatgccacgatcggctatgac
acggcctgcatgacggcaatggacgcgatcgacaagatccgtgacactgcttctagccac
caccgcgtcttcattgtcaacgtaatgggccgcaactgtggtgacatcgctatgcgcgtc
ggcgtagcctgcggggcggacgcgatcgtcattcctgaaagaccatatgatgtcgaagaa
atcgccaaccggctcaagcaagcccaggaaagcggcaaggaccacggtttggtagttgtt
gctgaaggcgtaatgaccgctgaccaattcatggctgaactgaagaagtatggtgacttc
gacgtccgggccaatgttttgggtcacatgcagcggggcggcacgccaactgtttctgac
cgggtgctggcttccaagctgggcagcgaagccgttcaccttcttttggaaggcaagggc
ggcctggctgtcggcattgaaaacggcaaggttacttcacacgacatccttgatttattt
gatgagtctcacaggggtgactatgacttgttaaagctcaacgcagatttatcaagatag

DBGET integrated database retrieval system