KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1375Help
Entry
LBU_1375          CDS       T01957                                 

Definition
Helicase Holliday junction
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ldl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1442738..1443331)
Genome map
AA seq 197 aa AA seqDB search
MYEYFEGTITVVNPAYVVIEVAGIGYRILTPTPYAYKEGDKARIYVEQVVRENGMTLYGF
KSQQDKVLFNKLNEVSGIGPKSALAIMAAEDNGALASAIESGEVSYLTRFPGIGKKTASQ
IVLDLRGKMGNYVAENLFTEDEPVESVFPALEDALLALGALGYSQKEVDRIKPKLKKLPE
MSADEYIKQGLGFLLKK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtattttgagggcaccattaccgtggttaatccggcctatgtcgtgattgaa
gtggccgggatcggctaccggatcctgaccccgaccccttatgcctataaagaaggggac
aaggcccggatctacgttgaacaggtcgtccgggaaaacgggatgaccctctacggcttc
aagagccagcaagacaaggtcctcttcaacaagcttaatgaagtttccggaatcggtcct
aagtctgccctggccatcatggccgctgaagacaacggagccctggcttccgccattgag
agcggcgaagtttcctacttgacccgtttcccggggatcggtaagaagacggcatcccag
atcgtcctggacttgcgggggaagatgggcaactatgtggcggaaaacctctttaccgaa
gatgaaccggttgagtctgttttcccagccctggaagacgccctcctggcccttggggct
ttgggctacagtcaaaaggaagttgaccggatcaagccgaaactgaagaaactgccggaa
atgtccgctgacgaatacatcaagcaggggctgggctttttgctgaagaaataa

DBGET integrated database retrieval system