KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1394Help
Entry
LBU_1394          CDS       T01957                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBU_1394
DNA repair and recombination proteins [BR:ldl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LBU_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1460732..1461331)
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIARLIDSFMKLPGIGEKTATRLAFYAMDMPKEDVDEFAQALVDVKEKLRQCSVC
GNITEQDPCAICSNPVRDRSTIMVVEEAKDVMAFENMGEYDGLYHVLHGVLSPMDGIGPE
QINIKSLIVRLQKNDAAKEVILALNSTPEGESTAMYISRLIKPAGLKVTRLAAGLAVGSD
IEYANLITLKRAVQGRTEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatacccattgccaatcgcccgcttgatcgattccttcatgaaactgccgggcatc
ggtgaaaagacggcgacccgcctggccttttacgccatggacatgcctaaagaagacgtg
gacgaattcgcccaggctctggtcgacgttaaggaaaagctgcgccagtgctcggtctgc
ggcaacatcaccgaacaagacccttgcgccatctgcagcaatccagtccgggaccggtca
accatcatggtggttgaggaagccaaggacgtgatggcctttgaaaatatgggcgaatat
gacggcctctaccatgtcctgcatggggtcttgtccccgatggacgggatcgggccggag
cagatcaacatcaagtccttgatcgtccgcctgcagaaaaatgatgctgccaaagaagtc
atcctggcccttaattccaccccggaaggggagtcaacggccatgtacatttcccgcttg
atcaagccggccggcctcaaggttacccggctggccgcgggcctggcggtcggctcagac
attgagtatgccaacttgatcactttgaagcgggcagttcagggtagaacggagctatag

DBGET integrated database retrieval system