KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1438Help
Entry
LBU_1438          CDS       T01957                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LBU_1438
Enzymes [BR:ldl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LBU_1438
Amino acid related enzymes [BR:ldl01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LBU_1438
Transfer RNA biogenesis [BR:ldl03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LBU_1438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1495422..1496924)
Genome map
AA seq 500 aa AA seqDB search
MANKKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGSLVLRIEDTDTARNVEGGAESQ
IENLHWLGIDWDEGPDIGGDYGPYKQSERKDIYQKYIDQLLEEGKAYYSFKTEEELEAQR
EEQRAMGIAPHYVYEYEGMTTDEIKQAQDEARAKGLKPVVRIHIPEGVTYEWDDIVKGHL
SFESDTIGGDFVIQKRDGMPTYNFAVVIDDHLMEISHVLRGDDHISNTPKQLCVYEALGW
EAPVFGHMTLIINSATGKKLSKRDESVLQFIEQYRELGFLPEAMFNFITLLGWSPVGESE
IFSKREFIKQFDPARLSKSPAAFDQKKLDWVNNQYMKTADRDELLDLALHNLQEAGLVEA
NPAPGKMEWVRQLVNMYANQMSYTKQIVDLSKIFFTEAKYLTDEEVEEIKKDEARPAIEE
FKKQLDKLDNFTAKKIMDAIMATRRETGIKGRKLFMPIRIATTRSMVGPGIGEAMELMGK
DTVMKHLDLTLKQLSEAGIE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ttggctaataagaaaatccgcgtgagatacgctccgtcaccaactggccacttgcacatt
ggtaacgcgcgtactgctctgtttaactatctgtttgcacgtcacaacaaggggtctttg
gttctgagaatcgaagacactgacaccgccagaaacgttgaaggcggggctgaatctcaa
atcgaaaacctgcactggctggggatcgactgggatgaaggtccggacatcggtggggac
tacggcccttacaagcagtccgaaagaaaggacatctaccaaaagtacatcgaccagctg
cttgaagaaggcaaggcttactactcctttaaaactgaagaagaactggaagcccagcgt
gaagaacagcgggccatggggattgctccgcactatgtctacgaatacgaaggcatgact
actgacgaaatcaagcaggcacaagacgaagcccgggccaagggcttgaagccagttgtc
cgcattcacattccagaaggcgtgacttacgaatgggacgacatcgttaagggccacttg
agctttgaatccgacactatcggcggtgacttcgtcatccaaaagcgcgacgggatgcca
acttacaactttgccgtcgttatcgacgaccacttgatggaaatcagccacgtgctccgg
ggcgatgaccacatctctaacacgccaaagcagctttgcgtttacgaagctttgggctgg
gaggctccagtcttcggccacatgactttgatcatcaactccgctactggcaagaagctg
tccaagcgtgacgaatcagtcctgcagttcatcgaacaatacagagaacttggtttcctg
ccagaagccatgttcaacttcatcactttgttgggctggtcgccagttggcgaaagcgaa
atcttctccaagcgcgaattcatcaagcaatttgacccggcccgtctgtccaagtcccca
gctgcctttgaccaaaagaagctggactgggtcaacaaccagtacatgaagacggctgac
agagatgaacttttggacctggccctgcacaacctgcaagaagctggcctggttgaagct
aacccggctccaggcaagatggaatgggtaagacaattggtgaacatgtacgccaaccaa
atgtcctacaccaagcaaatcgttgacttgagcaagatcttcttcactgaagcaaaatac
ctgactgacgaagaagtggaagaaatcaagaaggacgaagctcgtccggcgattgaagaa
ttcaagaagcaactggacaagctggacaacttcacggccaagaagatcatggacgccatc
atggctacccggagggaaactggcatcaagggccgcaagctcttcatgccaatccggatc
gctactacccggtcaatggtcggccctggcatcggcgaagctatggaattgatgggcaag
gacacggtcatgaagcacctggacttgaccttgaagcagcttagcgaagctggcatcgaa
taa

DBGET integrated database retrieval system