KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1438Help
Entry
LBU_1438          CDS       T01957                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ldl00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1495422..1496924)
Genome map
AA seq 500 aa AA seqDB search
MANKKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGSLVLRIEDTDTARNVEGGAESQ
IENLHWLGIDWDEGPDIGGDYGPYKQSERKDIYQKYIDQLLEEGKAYYSFKTEEELEAQR
EEQRAMGIAPHYVYEYEGMTTDEIKQAQDEARAKGLKPVVRIHIPEGVTYEWDDIVKGHL
SFESDTIGGDFVIQKRDGMPTYNFAVVIDDHLMEISHVLRGDDHISNTPKQLCVYEALGW
EAPVFGHMTLIINSATGKKLSKRDESVLQFIEQYRELGFLPEAMFNFITLLGWSPVGESE
IFSKREFIKQFDPARLSKSPAAFDQKKLDWVNNQYMKTADRDELLDLALHNLQEAGLVEA
NPAPGKMEWVRQLVNMYANQMSYTKQIVDLSKIFFTEAKYLTDEEVEEIKKDEARPAIEE
FKKQLDKLDNFTAKKIMDAIMATRRETGIKGRKLFMPIRIATTRSMVGPGIGEAMELMGK
DTVMKHLDLTLKQLSEAGIE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ttggctaataagaaaatccgcgtgagatacgctccgtcaccaactggccacttgcacatt
ggtaacgcgcgtactgctctgtttaactatctgtttgcacgtcacaacaaggggtctttg
gttctgagaatcgaagacactgacaccgccagaaacgttgaaggcggggctgaatctcaa
atcgaaaacctgcactggctggggatcgactgggatgaaggtccggacatcggtggggac
tacggcccttacaagcagtccgaaagaaaggacatctaccaaaagtacatcgaccagctg
cttgaagaaggcaaggcttactactcctttaaaactgaagaagaactggaagcccagcgt
gaagaacagcgggccatggggattgctccgcactatgtctacgaatacgaaggcatgact
actgacgaaatcaagcaggcacaagacgaagcccgggccaagggcttgaagccagttgtc
cgcattcacattccagaaggcgtgacttacgaatgggacgacatcgttaagggccacttg
agctttgaatccgacactatcggcggtgacttcgtcatccaaaagcgcgacgggatgcca
acttacaactttgccgtcgttatcgacgaccacttgatggaaatcagccacgtgctccgg
ggcgatgaccacatctctaacacgccaaagcagctttgcgtttacgaagctttgggctgg
gaggctccagtcttcggccacatgactttgatcatcaactccgctactggcaagaagctg
tccaagcgtgacgaatcagtcctgcagttcatcgaacaatacagagaacttggtttcctg
ccagaagccatgttcaacttcatcactttgttgggctggtcgccagttggcgaaagcgaa
atcttctccaagcgcgaattcatcaagcaatttgacccggcccgtctgtccaagtcccca
gctgcctttgaccaaaagaagctggactgggtcaacaaccagtacatgaagacggctgac
agagatgaacttttggacctggccctgcacaacctgcaagaagctggcctggttgaagct
aacccggctccaggcaagatggaatgggtaagacaattggtgaacatgtacgccaaccaa
atgtcctacaccaagcaaatcgttgacttgagcaagatcttcttcactgaagcaaaatac
ctgactgacgaagaagtggaagaaatcaagaaggacgaagctcgtccggcgattgaagaa
ttcaagaagcaactggacaagctggacaacttcacggccaagaagatcatggacgccatc
atggctacccggagggaaactggcatcaagggccgcaagctcttcatgccaatccggatc
gctactacccggtcaatggtcggccctggcatcggcgaagctatggaattgatgggcaag
gacacggtcatgaagcacctggacttgaccttgaagcagcttagcgaagctggcatcgaa
taa

DBGET integrated database retrieval system