KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1496Help
Entry
LBU_1496          CDS       T01957                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBU_1496
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBU_1496
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LBU_1496
Enzymes [BR:ldl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LBU_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1552822..1554300
Genome map
AA seq 492 aa AA seqDB search
MIYRSTRSQGQEVTTAQAIVQGLAPDGGLFVPKEFPAPFSAAALKEIFALPYQDMAKKIL
ALFLTDYSAEQLAEIVKGAYGQQWDDDRIAPLTDKKAGNYYLELFHGPTLAFKDVALQCL
PRLMKTALENSDDHRGIVILTATSGDTGTAAMRGFQSLAKTRVIVFYPYQGVAPIQLKQM
LSENSDNTVAVAVEGNFDQAQTRVKQIFNDPDMNSLLADHDLTFSSANSMNVGRLLPQVV
YYFAAYKQLLDHEAIAFGDPVNFSVPTGNFGDILAGHYAQKLGLPVGHLICASNKNNVLT
DFFKTGKYDKKRDFYVTNSPSMDILVSSNLERLLFDLCQNPDTVKSLMERLNTKGEYQLP
EDMQKKLSGFWADYATPEEIEGEIKRVYEESGYVIDPHTAVASLAAKRFKEEDDKPTVVL
STASPYKFPETVYHAISGQTVKEKGLPALKELTDLAGPAPKAMEAFLGHSSQEIVIPADN
MANEVKRQLDLD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccgcagtacccgcagccaggggcaggaagttaccactgcccaggcaatcgtc
caaggcctggccccagatggcggccttttcgtgcccaaagaattcccggctccattttca
gccgctgctttaaaggaaatttttgccctgccttaccaggatatggctaaaaagattctg
gctttgttcttaaccgactacagtgcagagcagctagcagagattgttaaaggcgcctac
ggccagcaatgggatgacgaccggatcgccccgctgactgataagaaggccggcaattac
tacttggagctcttccacgggccaaccctggcctttaaggacgtggccttgcagtgcctg
ccccgcttgatgaagacggccttggaaaactcagacgaccacagggggatcgtgattttg
acagcgacttccggggacaccgggaccgccgccatgcggggcttccagtccttagccaaa
acccgggtcatcgtcttttacccttaccaaggggtggccccgatccagcttaagcagatg
ctgagcgaaaacagcgacaacaccgtggctgtagcggttgagggcaactttgaccaggcc
cagaccagggtcaagcagatttttaacgacccggacatgaacagtttgctggctgaccac
gatttgaccttctccagcgccaactccatgaatgttggccgcctcttgccccaggtcgtc
tactacttcgccgcctacaagcagctgctggaccatgaagccattgcctttggcgatccc
gtcaacttctccgtgccaactggcaatttcggcgacattctggccggccattatgctcaa
aaactgggcctgccagtcggccacctgatctgcgcttccaacaagaacaatgtcttaacc
gactttttcaagacgggcaagtatgacaagaagcgggacttctacgtgaccaactcccca
tccatggacatcctggtttccagcaacctggagcgcctgctctttgacctctgccagaac
ccggacacggtcaagtctttgatggagcggctgaatacaaagggcgaataccaattgcca
gaagacatgcaaaagaagctttccggcttctgggccgactacgccactccggaagaaatc
gagggcgaaatcaaacgggtttacgaagaaagcggctatgtcatcgacccgcacacggct
gtcgcttctttagccgccaagcgctttaaggaagaagacgataagccaactgtcgtcctc
tctaccgccagcccttacaagttcccggaaaccgtctaccacgccatcagcgggcaaact
gttaaggaaaaaggcctgccagcccttaaggaactgactgacctagccggccctgcccca
aaggccatggaggcctttttaggccacagctcccaggaaatcgtcatcccggctgataac
atggcaaacgaagtcaagcggcagctggatctggactga

DBGET integrated database retrieval system