KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1496Help
Entry
LBU_1496          CDS       T01957                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ldl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ldl00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ldl00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1552822..1554300
Genome map
AA seq 492 aa AA seqDB search
MIYRSTRSQGQEVTTAQAIVQGLAPDGGLFVPKEFPAPFSAAALKEIFALPYQDMAKKIL
ALFLTDYSAEQLAEIVKGAYGQQWDDDRIAPLTDKKAGNYYLELFHGPTLAFKDVALQCL
PRLMKTALENSDDHRGIVILTATSGDTGTAAMRGFQSLAKTRVIVFYPYQGVAPIQLKQM
LSENSDNTVAVAVEGNFDQAQTRVKQIFNDPDMNSLLADHDLTFSSANSMNVGRLLPQVV
YYFAAYKQLLDHEAIAFGDPVNFSVPTGNFGDILAGHYAQKLGLPVGHLICASNKNNVLT
DFFKTGKYDKKRDFYVTNSPSMDILVSSNLERLLFDLCQNPDTVKSLMERLNTKGEYQLP
EDMQKKLSGFWADYATPEEIEGEIKRVYEESGYVIDPHTAVASLAAKRFKEEDDKPTVVL
STASPYKFPETVYHAISGQTVKEKGLPALKELTDLAGPAPKAMEAFLGHSSQEIVIPADN
MANEVKRQLDLD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccgcagtacccgcagccaggggcaggaagttaccactgcccaggcaatcgtc
caaggcctggccccagatggcggccttttcgtgcccaaagaattcccggctccattttca
gccgctgctttaaaggaaatttttgccctgccttaccaggatatggctaaaaagattctg
gctttgttcttaaccgactacagtgcagagcagctagcagagattgttaaaggcgcctac
ggccagcaatgggatgacgaccggatcgccccgctgactgataagaaggccggcaattac
tacttggagctcttccacgggccaaccctggcctttaaggacgtggccttgcagtgcctg
ccccgcttgatgaagacggccttggaaaactcagacgaccacagggggatcgtgattttg
acagcgacttccggggacaccgggaccgccgccatgcggggcttccagtccttagccaaa
acccgggtcatcgtcttttacccttaccaaggggtggccccgatccagcttaagcagatg
ctgagcgaaaacagcgacaacaccgtggctgtagcggttgagggcaactttgaccaggcc
cagaccagggtcaagcagatttttaacgacccggacatgaacagtttgctggctgaccac
gatttgaccttctccagcgccaactccatgaatgttggccgcctcttgccccaggtcgtc
tactacttcgccgcctacaagcagctgctggaccatgaagccattgcctttggcgatccc
gtcaacttctccgtgccaactggcaatttcggcgacattctggccggccattatgctcaa
aaactgggcctgccagtcggccacctgatctgcgcttccaacaagaacaatgtcttaacc
gactttttcaagacgggcaagtatgacaagaagcgggacttctacgtgaccaactcccca
tccatggacatcctggtttccagcaacctggagcgcctgctctttgacctctgccagaac
ccggacacggtcaagtctttgatggagcggctgaatacaaagggcgaataccaattgcca
gaagacatgcaaaagaagctttccggcttctgggccgactacgccactccggaagaaatc
gagggcgaaatcaaacgggtttacgaagaaagcggctatgtcatcgacccgcacacggct
gtcgcttctttagccgccaagcgctttaaggaagaagacgataagccaactgtcgtcctc
tctaccgccagcccttacaagttcccggaaaccgtctaccacgccatcagcgggcaaact
gttaaggaaaaaggcctgccagcccttaaggaactgactgacctagccggccctgcccca
aaggccatggaggcctttttaggccacagctcccaggaaatcgtcatcccggctgataac
atggcaaacgaagtcaagcggcagctggatctggactga

DBGET integrated database retrieval system