KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1496Help
Entry
LBU_1496          CDS       T01957                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
ldl00260  Glycine, serine and threonine metabolism
ldl00750  Vitamin B6 metabolism
ldl01100  Metabolic pathways
ldl01110  Biosynthesis of secondary metabolites
ldl01120  Microbial metabolism in diverse environments
ldl01230  Biosynthesis of amino acids
Module
ldl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBU_1496
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LBU_1496
Enzymes [BR:ldl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LBU_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP dCache_1
Motif
Other DBs
NCBI-ProteinID: ADY85681
UniProt: F0JZQ8
Position
1552822..1554300
Genome map
AA seq 492 aa AA seqDB search
MIYRSTRSQGQEVTTAQAIVQGLAPDGGLFVPKEFPAPFSAAALKEIFALPYQDMAKKIL
ALFLTDYSAEQLAEIVKGAYGQQWDDDRIAPLTDKKAGNYYLELFHGPTLAFKDVALQCL
PRLMKTALENSDDHRGIVILTATSGDTGTAAMRGFQSLAKTRVIVFYPYQGVAPIQLKQM
LSENSDNTVAVAVEGNFDQAQTRVKQIFNDPDMNSLLADHDLTFSSANSMNVGRLLPQVV
YYFAAYKQLLDHEAIAFGDPVNFSVPTGNFGDILAGHYAQKLGLPVGHLICASNKNNVLT
DFFKTGKYDKKRDFYVTNSPSMDILVSSNLERLLFDLCQNPDTVKSLMERLNTKGEYQLP
EDMQKKLSGFWADYATPEEIEGEIKRVYEESGYVIDPHTAVASLAAKRFKEEDDKPTVVL
STASPYKFPETVYHAISGQTVKEKGLPALKELTDLAGPAPKAMEAFLGHSSQEIVIPADN
MANEVKRQLDLD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccgcagtacccgcagccaggggcaggaagttaccactgcccaggcaatcgtc
caaggcctggccccagatggcggccttttcgtgcccaaagaattcccggctccattttca
gccgctgctttaaaggaaatttttgccctgccttaccaggatatggctaaaaagattctg
gctttgttcttaaccgactacagtgcagagcagctagcagagattgttaaaggcgcctac
ggccagcaatgggatgacgaccggatcgccccgctgactgataagaaggccggcaattac
tacttggagctcttccacgggccaaccctggcctttaaggacgtggccttgcagtgcctg
ccccgcttgatgaagacggccttggaaaactcagacgaccacagggggatcgtgattttg
acagcgacttccggggacaccgggaccgccgccatgcggggcttccagtccttagccaaa
acccgggtcatcgtcttttacccttaccaaggggtggccccgatccagcttaagcagatg
ctgagcgaaaacagcgacaacaccgtggctgtagcggttgagggcaactttgaccaggcc
cagaccagggtcaagcagatttttaacgacccggacatgaacagtttgctggctgaccac
gatttgaccttctccagcgccaactccatgaatgttggccgcctcttgccccaggtcgtc
tactacttcgccgcctacaagcagctgctggaccatgaagccattgcctttggcgatccc
gtcaacttctccgtgccaactggcaatttcggcgacattctggccggccattatgctcaa
aaactgggcctgccagtcggccacctgatctgcgcttccaacaagaacaatgtcttaacc
gactttttcaagacgggcaagtatgacaagaagcgggacttctacgtgaccaactcccca
tccatggacatcctggtttccagcaacctggagcgcctgctctttgacctctgccagaac
ccggacacggtcaagtctttgatggagcggctgaatacaaagggcgaataccaattgcca
gaagacatgcaaaagaagctttccggcttctgggccgactacgccactccggaagaaatc
gagggcgaaatcaaacgggtttacgaagaaagcggctatgtcatcgacccgcacacggct
gtcgcttctttagccgccaagcgctttaaggaagaagacgataagccaactgtcgtcctc
tctaccgccagcccttacaagttcccggaaaccgtctaccacgccatcagcgggcaaact
gttaaggaaaaaggcctgccagcccttaaggaactgactgacctagccggccctgcccca
aaggccatggaggcctttttaggccacagctcccaggaaatcgtcatcccggctgataac
atggcaaacgaagtcaagcggcagctggatctggactga

DBGET integrated database retrieval system