KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1639Help
Entry
LBU_1639          CDS       T01957                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
ldl00230  Purine metabolism
ldl01100  Metabolic pathways
Module
ldl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LBU_1639
Enzymes [BR:ldl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LBU_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 AAA_22 ABC_tran CPT dNK Zeta_toxin SKI Thymidylate_kin PRK AAA_23 AAA_17 RsgA_GTPase AAA_28 AAA_5 AAA_24 AAA_29 MMR_HSR1 Cytidylate_kin Rad17 AAA_14 T2SSE APS_kinase TsaE SRPRB RNA_helicase PduV-EutP
Motif
Other DBs
NCBI-ProteinID: ADY85824
UniProt: F0K0K8
Position
complement(1701030..1701572)
Genome map
AA seq 180 aa AA seqDB search
MAKKIILIAGPSGAGKTTISEYLTDRYQIPRVITHTTRPKRPGESGSAYYFEDDDSFAQL
HFFEHVKYGDYQYGSSKEGLERAWAKNDLVSLIVDIKGARSYLEALGDQVYFLYVTCSLD
TLAQRMADRGDASDQIKKRLTGSELNELPEDLASCAHVLVNDDLQATYASLDSLVRKLQN
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaaaaaattatcttgattgccggtcccagcggggcgggcaagacgactatatct
gaatacctgaccgaccgctaccagatcccccgggtgattacccataccacccggccaaag
cggcctggggaaagcgggtcagcctattattttgaagacgatgattcttttgcccaactg
cacttctttgaacatgtcaaatacggggactaccagtacgggtccagtaaagaagggctg
gaaagagcctgggccaagaacgacctggtcagcttgatcgtggacatcaagggagcccgg
tcctacctggaagctttaggtgaccaggtttacttcctttatgtgacttgcagcctggat
accttggcgcaaagaatggctgaccggggtgatgcaagtgaccagatcaagaagcggctg
accggcagcgagttgaacgaattgccggaagatttggcttcttgcgcccatgtcctggtc
aatgacgacctgcaagcgacctatgccagcttggacagtttggtgagaaaattacaaaat
taa

DBGET integrated database retrieval system