KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1661Help
Entry
LBU_1661          CDS       T01957                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysine ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ldl00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ldl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1722469..1724019)
Genome map
AA seq 516 aa AA seqDB search
MNISLNTCILILKEHHLLKSSAVQDTVQTIMEAVSYDSRDVQNNSLFFCKGAGFRPTYLT
MAKENGAIAYVAEQPYPEGTGMHALIVRNVSKAMALLSAAFYSFPQDDLFLVGFTGTKGK
TTSAYFLKGMLDQLNGGRTALLSSVDNILGPAPEDTFKSSLTTPESLDLFRDMRRAVDNG
MTHMVMEVSSQAYKKSRVFGLTYDLGFFLNISPDHIGVNEHPNFEDYLHCKLQLLVNSRK
CIINAETDRFADVYAAATTTTNPDSIYLFARDGFENPDLKKPIDFRYKSVETDLAETKFT
LTTASSKAHKLPISGEYTLQMIGDFNETNATGAIIGAGLAGMSYEDCAKGIRHVTIPGRM
ETVTTQKHGLIVVDYAHNKASMLALMRFMRREFTTPRVIVVVGAPGDKGISRRPGFSESL
TAEADKAYLTTDDPGFENAQDICEEIDAGIDHSKCETVIELDREKAIKEAISEAGPDDVV
LLCGKGADAFQKIRGVDTPYAGDIVIARQVIQELEK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctcattaaacacctgtattttaatcttaaaagaacaccacctgctcaagtcc
agtgccgtccaggacactgtccagaccataatggaggctgtttcttatgactcacgcgat
gtccagaacaacagcctcttcttctgcaagggggcgggcttccggccaacctacctgacc
atggccaaggaaaacggggcaattgcctacgtggctgagcagccatacccggaaggcacg
gggatgcacgccttgatcgtccgcaacgtgtccaaggcgatggcccttttgtcagctgcc
ttctacagcttcccgcaagacgacctcttcctggttggctttaccgggaccaagggcaag
accacttccgcctacttcttaaaggggatgctggaccagctcaacgggggccggactgct
cttttgtcctcagtcgacaacatcctcgggccggctccggaagacaccttcaagtccagc
ctgaccacgccggaatcactggacttgttcagagacatgcggcgggcagttgacaacggc
atgacccacatggttatggaagtgtcatcccaagcctacaagaagagccgggtctttggc
ctgacctacgacctgggcttcttcctgaacatcagcccggaccacatcggggtcaacgag
cacccgaactttgaggactacctccactgcaagctgcagcttttggttaactcccgcaag
tgcatcatcaacgcggaaaccgaccgttttgctgatgtttacgcggcagcaacgaccacg
accaacccggacagcatctacctgtttgcccgggacggctttgaaaatccggatctgaag
aagccaatcgacttccgctacaagtccgtggaaactgacctggctgaaaccaagttcacc
ttgactacggcttcaagcaaggcccacaagctgccaatctctggtgaatacactctgcag
atgatcggcgacttcaacgaaaccaacgctaccggcgccatcatcggggctggcctagcc
ggaatgagttatgaagactgcgccaaggggatccggcacgtgaccatcccaggccggatg
gaaaccgtcacgacccaaaagcacggcttgattgtggtggactatgcccacaacaaggcc
tccatgctggccttgatgcggttcatgcgccgggaattcaccaccccccgggtcatcgtc
gtggtcggcgcgcctggggacaagggaatttcccgccggccgggcttcagtgaaagcttg
acggcggaagctgacaaggcctacctgaccacggacgaccctggctttgaaaatgcccag
gacatctgcgaggaaatcgatgccgggatcgaccactccaagtgtgaaacggttattgaa
ctggaccgggagaaggccatcaaggaagccatttccgaagctggcccggacgacgtggtc
ctgctctgcggcaagggggctgacgccttccagaagatccgcggggtagacactccatat
gccggcgatattgttatcgcccggcaagtgatccaggaattagaaaagtag

DBGET integrated database retrieval system