KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1719Help
Entry
LBU_1719          CDS       T01957                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBU_1719
Enzymes [BR:ldl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LBU_1719
Exosome [BR:ldl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBU_1719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1780564..1781349)
Genome map
AA seq 261 aa AA seqDB search
MAGDQQAALFGQLAVKPGMVKNTYGTGSFIVMNTGEEPIESKNNLLTTIGYKLGDQVNYA
LEGSVFVAGSAIQWLRDSVKLLNSAPESEQAALESKDANEVYVVPAFTGLGAPYWDSEAR
GAIFGLTRGSSDKDLIKATLQSLGYQIRDVVDTMQKDSGIEIPVLRVDGGASNNNYLLQF
QADLLGKKIERAADLETTGLGAAFLAGLAVGYWQDLDSLKEIAKTGAAFAPKMEEAERDR
LYAGWQRAVLATRVFAHGKDF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccggggaccagcaggcggccttgtttggccaattggccgtcaagccgggcatggtc
aagaacacctacgggaccgggtctttcatcgtgatgaacacgggggaggaaccgattgaa
tccaagaataatttgctgacgactattggctacaagctgggcgatcaagtaaactatgct
ttggaagggtcagtcttcgtggccgggtcagccatccagtggctgagagactcggtcaag
ctgctgaactcagctccggaatcagagcaggcggccctggaatctaaagacgccaatgaa
gtctatgtggttcccgcctttactggtttgggggcaccatactgggacagtgaagcccgg
ggggcgatttttggcttgaccagaggcagcagtgacaaggacttgatcaaggcaactctg
cagtccttgggctaccagatccgggatgtggtcgacaccatgcagaaggactcgggcatt
gagattccggttctcagagtcgacggcggggcttcaaacaacaactacctcctccagttc
caggcagacctgttaggcaagaagatcgagcgggcagcggatttggaaaccactggcctg
ggggcagcctttctggcaggtttagccgtcggctactggcaagacctggatagcttgaag
gaaattgccaagaccggggccgcctttgcaccaaagatggaagaggcggaaagagaccgg
ctctacgcgggctggcagcgggcggttctggccacccgggtctttgcccacgggaaagat
ttttag

DBGET integrated database retrieval system