KEGG   Lactobacillus delbrueckii subsp. bulgaricus 2038: LBU_1728Help
Entry
LBU_1728          CDS       T01957                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ldl  Lactobacillus delbrueckii subsp. bulgaricus 2038
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ldl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ldl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1794459..1795415)
Genome map
AA seq 318 aa AA seqDB search
MKKLNLVALPHFVSVENLKNDEVKALIKRAEYFKKGGAVARLTSPVYVTNMFFEDSSRTH
TSFEMAERKLGLTVIPFDPAHSSVNKGETLYDTSLVMNALGIDLEVIRHSQNEYYEDLIN
LKQHQKLNIGVINAGDGSGQHPSQCMLDMMTIHEHFGHFKGLKVAIVGDITNSRVAKSDM
ELLTKLGAEVYFSGPECWYSEEFDQYGKHEELDKLIPEMDVMMLLRVQHERHSGDPNEKK
FDAHRYHEKYGINHKRYEAMKKDAIIMHPGPINHDVELSGDLVESDKCMFVRQMENGVFM
RMAMLEAVLRGRKLGGLE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaaatcttgtcgctttaccacattttgttagtgttgaaaatttgaaaaat
gatgaagtaaaggctctgattaagcgtgcggaatatttcaaaaaaggtggagctgtagct
aggttaactagtccggtctatgtcactaacatgttttttgaagattcaagcagaacccac
accagctttgagatggctgaaagaaagttaggcttgactgtgattccatttgatccagct
cattcatctgtcaacaagggtgagaccttatacgacacttcactagtgatgaatgcactt
ggcatcgaccttgaagtaattcgccactcacaaaatgaatattacgaggatttgattaat
ttaaagcagcatcaaaaattaaacatcggtgtgattaatgcaggagatggctcaggtcag
catcccagtcaatgcatgcttgatatgatgactattcatgaacactttggccattttaaa
ggtttgaaagtggcaatcgtaggtgacatcactaattctcgcgtagctaaaagtgacatg
gaacttttaactaaactcggtgctgaagtttacttctccggccctgaatgttggtactct
gaagaattcgatcaatatgggaagcatgaagaacttgataaattgatccctgaaatggat
gtcatgatgttgctacgggtgcaacacgaacgtcatagcggtgatcctaatgaaaagaag
tttgatgcacatcgttatcatgaaaaatacggtattaatcacaaacgatatgaagcaatg
aaaaaagatgcgatcatcatgcacccgggtccaattaatcacgatgtcgaattaagtggc
gacctggtagaaagtgacaagtgcatgtttgttcgccaaatggaaaacggcgtctttatg
agaatggccatgttggaagcagttttgcgtggcagaaaactcggagggcttgaataa

DBGET integrated database retrieval system