KEGG   Leishmania donovani: LDBPK_010330Help
Entry
LDBPK_010330      CDS       T02289                                 

Definition
poly(A) export protein, putative
Orthology
K14298  
mRNA export factor
Organism
ldo  Leishmania donovani
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LDBPK_010330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:83004..83927
Genome map
AA seq 307 aa AA seqDB search
MLMTGVASWDGTCSIWQVARNPAGAVISQPTWTTTHDSPLLTMSLSADGRVFFGGCSKTA
VMWDLNSNQKAVVASHDLPISCLDFLSLPQTMSQMLITGSWDGKLRWWDLRQQSYVREEN
LGEPVFALDAQKTVPMMAAATGRLAHVYDVQQMQKVNELKLPDVMKFNLRCITCAPQYDG
VGVGSSEGRVSFISMKDAPGCTFKAHITTEKSHYILSQTNFCVHHPTLPLLLSGGGDGNL
TVINRADRKVIKTLQCEQKVGTQAIPISAGDISADGSLVAYAHSYDWAMGKSGYRNQPTS
VHIRPLL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgaccggcgttgcctcgtgggacgggacttgctctatttggcaggttgcgcgg
aaccctgctggggcggtcatatctcagccaacttggacaacaacacacgacagtccttta
cttactatgtccttgtctgcggacgggcgcgtctttttcggaggatgctcaaagactgcg
gttatgtgggacctgaactcaaatcagaaggctgtcgtcgcatcacatgatttgccaatt
agctgcctcgatttcctgtctcttcctcagaccatgagccaaatgctcatcaccggaagc
tgggacggcaagctgcgctggtgggacctgaggcagcaaagctacgtgagggaggaaaac
ctgggtgagcctgtgttcgcgctcgatgcgcaaaaaacggtgccgatgatggctgccgca
acaggtcgactggctcacgtgtatgacgtgcaacaaatgcagaaggtcaacgaactcaag
cttcccgacgtcatgaaattcaacctccgctgcatcacatgcgctccacagtacgacggt
gtcggagtcggatcctcggaaggacgcgtctcctttatcagcatgaaggacgcgccaggg
tgcacattcaaggctcacattaccacagaaaagtctcactacattctgagccagaccaat
ttttgcgtgcatcaccctacgttgccactcctcctgtccggtggcggcgatggtaatttg
acagttatcaaccgcgccgatcgaaaagtcataaaaacgcttcaatgcgagcaaaaagta
ggcacacaagcaattccaatctcagctggcgacataagcgcagatgggtctcttgttgcc
tatgcgcatagctatgactgggccatggggaagagtggttacagaaaccaacctacctcg
gtgcacattcggccgctattgtga

DBGET integrated database retrieval system