KEGG   Leishmania donovani: LDBPK_070820Help
Entry
LDBPK_070820      CDS       T02289                                 

Definition
malonyl-coa decarboxylase-like protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
ldo  Leishmania donovani
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ldo00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ldo00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:ldo04146]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:329343..331736
Genome map
AA seq 797 aa AA seqDB search
MRCVYRPASGASGCCRATASGGTTLSAGTVAYASRHFSAPTRLSRSEPPPPPLPPLPGPG
ATVSEERVARWCRRLWDLTRKSTGSVASAHVTPQLQLAAHRATAALLSSSSASPFTAPLQ
IDDNGEVTGEVVLSCLRRAIRSDQGRIPGVIVESVWAAFDVLVPPIVQNSVTEDSITPAT
EDSFFMFISTLNELNFDLHAVVKASTQLTAKVDSYVALLRQAEAQETQQAATAAACGSAQ
AAIDGCELMEKLMKTKGEVMQCCFEARNAGSPLYYTWLWHTAAMPDGLRRLMHFRKLTHF
FESLCKRHIKHLMQQQQQQQQPQRRSLLSSSAPATGESAGTLPSAAASSATEQSRCAGEL
SKWRSRLVEVGLIDGAMSLLLHDLFSKEYLVMEELTWLSTPPSMLDQIMRAESVHPFVRG
LEDMRHRLQPAHHRHLFAFLHPAVVEEPLIAVQVALTHGIASSVDQILGRPTPLSDPANT
SKAALYFRHALESSAAVDCAGAAEDGNVNTAIFYSINSAQSALRGMDMGNRLIKRVVQEV
EGNINARRQARSLTPIHTFSTLSPIPLYVKWLADKVAALAAAAATATTMTASGIFGKQLS
ATEEDTRYLEPLRAAIAGYVLRHPGALPAEARAVMSAAAASSHGNHAAANIAALQYLVRL
LQDSSSPPSLPRDDPAMFAAGSTSTERHQQPWWMDHAFTMALEAPLLHSVATYLCTAKRS
GDGRIRDPVGNFHVSNGATVYRLNFLANTTPKASCESACIMVNYWYDLPTVSANAAQYEV
SRTVPLGEPIKTLLGDI
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgtgtttatcggcctgccagcggcgcgagtggctgctgcagagccactgctagc
ggcggcactaccctttccgccggcaccgtggcgtacgcctcgcggcacttcagtgcgcct
acgcgtctgtcgcgatcggaaccaccgccaccgccactcccgccactcccggggccaggc
gccacggtgagcgaggaacgtgtcgcacgatggtgtcggcggctgtgggacctcacgcgc
aagtccactggcagcgtggcctctgcccatgtcaccccacagcttcaactcgccgcccac
agagcaacagcagcactgttatcatcgtcgtcggcgtcccccttcaccgcgccactgcag
attgacgacaatggggaggtgacgggcgaggtggtgctgtcctgcctgcgccgcgccatc
cgtagcgatcagggccgcattcctggcgtcattgtggagagcgtgtgggccgccttcgac
gtgctcgtgccgcccatcgtccagaacagcgtcacagaggatagcatcacacccgcgacg
gaggatagcttctttatgttcatctcgaccttgaacgagctcaacttcgacctgcacgcg
gtcgtgaaggcaagcacgcagctgacagcgaaggtggactcctacgtggcccttctacgg
caggcggaggctcaagaaacgcagcaagcggcaacagcagctgcctgtggctctgcacag
gccgctatcgacggatgcgagctcatggagaagctcatgaagactaagggggaggtcatg
cagtgctgcttcgaggcccgcaacgccggctctcctctctactacacgtggttgtggcac
acggccgccatgccggacggcctgcggcggctcatgcattttcgaaagctgacccatttc
ttcgagagcttgtgcaagcgacacatcaaacatctcatgcagcagcagcagcagcagcag
cagccgcagcggcggagcttactgtcttcttcggcgcctgctactggcgagtctgcgggg
acgttgccatcagcagcagcatcaagcgccacggagcaaagtcgctgcgctggcgagctc
tccaagtggcgtagtcgtctcgtcgaggtaggcctaatcgatggtgccatgtcgcttctc
ttgcacgacctcttctccaaggagtacttggtgatggaggagctgacgtggctctcgacg
ccgccgtcgatgctggaccagatcatgcgtgccgagtctgtccatccgttcgtccgcgga
ctcgaagacatgcgccatcgcctgcaaccggctcaccaccgccacttgttcgcctttctg
caccccgccgttgtcgaggagccgctcatcgccgtgcaggtggccttgacacacggcatc
gccagctctgtggaccagatcttgggtcgccctacgccgctgtcagacccggcgaacacg
tcgaaggcggccctctacttccgccacgcactggaatcctcggcggcggttgactgcgcc
ggtgcggcggaagatggcaacgtgaacaccgccatcttctacagcatcaactctgcccag
agtgcgttgcgtggcatggacatgggcaaccgcctcatcaagcgcgtcgtgcaggaggtg
gagggcaacattaatgcccggcggcaggcgcgcagcttgactcccatccacaccttcagc
accctctcacccatcccactctacgtcaagtggctggctgataaggtggctgcgctggcg
gctgccgctgcgacagctaccacgatgacggcgagcggcatctttggcaagcagctctcc
gcaaccgaggaagatacgcgctacttggagccgcttcgcgcggcgattgccggctacgtc
ctgcggcaccccggtgccctaccggcggaggcgcgtgcggtgatgtcagcggcggccgca
agcagtcatggcaaccacgcggctgcaaacatagcggcactgcagtacctcgtgcgtctg
ctccaagactcatcttcgcccccctcgttgccgcgcgacgatcctgccatgttcgccgcg
ggcagcacctcgacagagcggcatcagcagccatggtggatggaccatgcgttcacgatg
gccctcgaggcgcccctgctgcactccgttgccacgtacctgtgcactgccaagcgtagt
ggtgatggccgcattcgcgacccagtcggcaactttcacgtgtctaatggcgccactgtt
tatcgactaaacttcctggcgaacacgaccccgaaggccagttgtgagagcgcctgcatc
atggtgaactactggtacgacctgccaacggtctcagccaacgctgcgcagtacgaggtg
agccgcaccgtgcccctcggtgagccgatcaagacgctgctgggggacatttag

DBGET integrated database retrieval system