KEGG   Leishmania donovani: LDBPK_090390Help
Entry
LDBPK_090390      CDS       T02289                                 

Definition
ubiqitin hydrolase, putative
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LDBPK_090390
Peptidases [BR:ldo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LDBPK_090390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:142806..145655
Genome map
AA seq 949 aa AA seqDB search
MRLRVLPRCRRTITSYLLSIMSATAASSRRKQHHESLKEESMISFEMELDEAIELPLDVS
AVAPTDAALSAPLGGKKITMPAARAASESRAAWSNGSTASLRFAVCGNGKELPNTPATAD
GVGSPIATPDNAATTTYSAAAPSRTLTWKDTSASQRRAEAQASRQDDFNPMVLCPLQNLG
NTCYFNAGVQLLVNCPALVYAVRNSPFAQSTQSNGPLTAHAVSMPRAEAATATTKLCLKG
GAATHTLFQEFSTLLARMEMGCAAGERAISPICALDSLAQAYPQFEGRSQQDAAEMMTSL
LASLEEEGGQYVEVAQLLQSFEEDAAALRQGVTSLASSPRASEPVARALKDATAPLLEAE
TAPSASPHRRDYSEPCNIEEYSQPSLLSSTSEDTFLPGPRSAHFFTVLRLMERVNRENEL
LERRVKQRQGIAYTNSFKPPRLHFNPLLDGFRGYTLSEVECHNCRAVSRVVSPFNGLLLD
VPTAKQRRRYALAHPNVPRRVDFDGQLRQVKKPFRLTWWNPLSLCVAAWRQLKRFFQDPF
PYPLWLDECLDIHFEPEVLRGCNRYRCESCDTTTDATKSETLLALPEYLLIHMKRFEAGR
FFNSKKSDSVFFPTSWRPLTKMQARQSPINTDDAPPALPEYLDLRHYLHSSVAPFAEPIP
PCLWSTGNEPHQQHHASRDDASSPASSIATTYTLDGIVNHHGGYDGGHYTVFLYKATEER
QAWVYISDDEVEQAEEVVATDTEYVLLYRRQPLVQAAPESDEAEQLRRKACYYLSQSSPS
CPAPNTAAATTAGPKSSKLHNRCPFSSSSAGGAASAPPHAATAATEPWVYISRMWLQRVV
FMHEPGPIVNRLCYCRPEDQGRVSMYRTIFPATVKVPAEVPHVHGPPVSWFYVPITQRDY
DIFYNAFGGNAAVTASEYESLRAMQGKFCAAIDLAERQRGSAARPAPRR
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgcgcgtgctgccacggtgtcgccgaaccatcacatcttacctgctgtccatc
atgtccgccacggcagcgtcgtcgcggcggaagcagcaccacgagtcgctcaaggaggag
tcgatgatctcgttcgagatggagctcgacgaggcgattgagctgccgctcgacgtgagc
gccgtcgcaccgacagacgcggcgctgagcgcgccgcttgggggtaaaaagatcacaatg
ccagctgcaagggccgcttcggagagcagggctgcatggagtaacggcagcaccgccagc
ctcagattcgccgtgtgcggcaacggaaaggagctcccaaacacccccgcaaccgccgac
ggcgtcggctctcccatcgccacgccagacaatgcagctaccacaacctactcggcggcg
gcgccgtcacgcacgttgacgtggaaggacaccagcgcgtctcagcggcgtgccgaggcg
caggcgagccgccaagacgacttcaaccccatggtcctatgcccgctgcagaacctgggc
aacacgtgctacttcaacgcgggtgtgcagctgctcgtgaactgccccgccctcgtctat
gcagtgcgcaactcgccatttgcgcagagtacacagagcaacggccccctcaccgcccac
gccgtatcgatgccgcgggctgaagcggcaacggcaacgacgaagctgtgcctgaaaggg
ggtgccgccacccacacgctcttccaggagttctccaccctgctcgcccgcatggaaatg
ggatgtgcagccggtgagagggcgatctcgcccatttgtgcgctcgactccctcgcgcag
gcgtatccgcagttcgagggtcgaagccagcaagacgccgcagagatgatgacgtcgctg
ctggccagcttggaggaggagggcggtcagtatgtggaagtggcacagctgctacagtcg
tttgaagaagatgccgcggcgctgcggcagggcgtgacgtccttggcctcctctccccgg
gcttcggagccagtggcgcgagctctaaaggacgccaccgcgcctctcttggaagccgag
accgcgccctccgcatcgccgcatcggcgcgattacagcgagccctgcaacatcgaggag
tactcccaaccatcgctgctctcctccactagtgaggacaccttcctgccgggtccgcgc
agcgcgcacttcttcaccgtactgcggctgatggaacgggtcaatcgcgagaacgaacta
cttgagcggcgtgtgaagcagcggcaaggcattgcctacaccaactccttcaagcccccg
cggctacacttcaacccgctgctggacggcttccgcgggtatacgctgtcggaggtggag
tgccacaactgccgcgcggtatcgcgcgtggtgagccccttcaatgggttgctgctggat
gtgccgacggcgaagcagcgccggcgctacgcgttggcgcacccgaatgtgccgcgccgc
gtcgacttcgatgggcagctgcggcaggtgaagaagccgtttcggctgacgtggtggaac
cccctctccctctgcgtggcggcgtggaggcagctgaagcggttcttccaggacccgttc
ccgtacccgctgtggctggacgagtgcctcgacattcacttcgagccggaggtgctgcgc
gggtgtaacaggtaccgttgcgagtcctgcgacaccaccaccgacgccaccaagtcggag
acgcttcttgccctgcccgagtacctgctcatccacatgaagcgcttcgaggccggccgc
ttctttaacagcaagaagtcggactcagtcttctttcccacctcgtggcggccgctcacg
aagatgcaggcgaggcagtcgcctatcaacacggacgacgcgccgccagcgctgccggag
tacctcgacctgcggcactacctgcacagcagcgtcgcaccgttcgcagagccgatcccg
ccctgtctgtggagcaccggcaacgagccccaccagcagcatcacgcgagcagggacgat
gccagcagccccgccagctccatcgcaaccacctacacgctagacggcattgtcaaccac
cacggcggctacgacggcggccattacaccgtcttcctctacaaggcgacggaggagcgg
caggcgtgggtgtacatcagcgacgatgaggtggagcaagcggaggaagtagtggcgaca
gataccgagtacgtcctgctgtatcgccgccaacccctcgtgcaggcggcaccagagtcg
gacgaggcagaacagctgcgccgaaaggcgtgctactacctctctcagtcatccccctcc
tgccctgccccaaacaccgcggcagcgacgaccgccggccctaaatccagcaagcttcat
aacaggtgccccttctcgtcctcttcggcaggcggcgcggctagtgcgccacctcacgcg
gcaaccgcggcgaccgagccgtgggtgtacatctcgcgcatgtggcttcagcgcgtcgtc
ttcatgcacgagccgggcccgattgtgaatcgcctgtgttactgccgtccagaggatcag
gggcgggtgagcatgtatcggaccatctttccagccacggtgaaagtgccggcggaggtg
ccccacgttcacggcccgccggtgagctggttctacgtgcccatcacacagcgggactac
gacattttttacaacgcgtttggcggcaacgcagccgtgacggcgagcgaatacgagtca
ctgcgtgcaatgcagggcaagttctgcgccgccattgatttagcggagcggcagcgaggc
agcgcagctcgccctgctccccggcgctga

DBGET integrated database retrieval system