KEGG   Leishmania donovani: LDBPK_100540Help
Entry
LDBPK_100540      CDS       T02289                                 

Definition
mitogen-activated protein kinase 3, putative
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ldo  Leishmania donovani
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
10:234712..235878
Genome map
AA seq 388 aa AA seqDB search
MHKSNQELSVPKIVGDFKVYNVSGSPFEVPSKYTLLKILGMGAYGIACSCLDGDTGEKVS
IKKCRDVFRDVEDGKRVLREIDMMRFFHHENLLNVVNILPPLKREYHSFEDVYVVTPLMD
VDMNVVLRSRQVLEESHMQYFVYQILRGLKYLHSANVAHRDLKPANLVTNISCELKIIDF
GLSRSVDVPYSELTDYVITRWYRPPELLLENTNYSTAVDIWSVGCIFAEMYNRKPVFPGR
NTMDQLRMIAQHIGKPPASIVEHREALEKLNELPDGSLNIPKLVPGLAGNTEGIDFLSKM
WTLDPSKRPTAADMLAHPYLAHLHDEEDEPTCPCPFLWAHESTPMGVSELRRAFWADIVD
YNPSLEQATPPVTTAGGSSSKNGSGHHH
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagagcaaccaggagctgagcgtgcccaagattgtgggggacttcaaggtgtac
aatgtgagcggctccccattcgaggttccgtccaagtacacgctgctcaagatcctcggc
atgggagcctacggtatcgcgtgcagctgcttggatggcgacactggcgagaaggtgtcc
attaagaagtgtcgcgacgtgttccgcgatgtggaggatggcaaacgagtgctgcgcgag
atcgatatgatgcgcttcttccaccacgaaaacctgctcaatgtggtgaacattttgcct
ccgctgaagcgcgagtaccacagcttcgaagacgtgtacgtcgtcaccccgctcatggac
gtagacatgaatgtcgtactgcgctctcgtcaggtgctcgaggagtcgcacatgcagtac
tttgtctaccagattctgcgtggcctcaagtacctgcacagcgcgaacgtcgcccaccgc
gacttgaagccagccaacctcgtcacaaacatctcttgtgagctcaagattatagacttc
gggctgagccgcagcgtcgatgtgccgtactcggagctcacggattacgtcatcacgcgc
tggtaccggccaccggagctgcttctggagaacacgaactattccaccgcagtggacata
tggtctgtcgggtgcatttttgcagagatgtacaaccgcaagcccgttttcccaggtcgc
aatacgatggaccagctgcgcatgatcgcgcagcacattggcaagccgccagccagcatc
gtcgagcaccgcgaggcgctggagaagctgaatgaactgccggacgggtcactcaacatt
cccaaactcgtccccgggctggccggcaacacggagggcatagactttctctccaagatg
tggacgctagacccgagcaagcgtccgaccgcggctgacatgctcgcgcacccatacctg
gcccacctgcacgacgaggaagatgagccgacctgcccctgccccttcctgtgggcacat
gagagcaccccgatgggcgtctcggagcttcgtcgcgccttctgggctgacattgttgac
tacaatccgtctctggagcaggccacgccgccggtgacgacggctggtggcagcagctca
aagaacggcagcggccaccatcactag

DBGET integrated database retrieval system