KEGG   Leishmania donovani: LDBPK_140020Help
Entry
LDBPK_140020      CDS       T02289                                 

Definition
phosphatidylinositol 3-kinase 2, putative
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
ldo  Leishmania donovani
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LDBPK_140020
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LDBPK_140020
Enzymes [BR:ldo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     LDBPK_140020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14:4127..7270
Genome map
AA seq 1047 aa AA seqDB search
MSLRVRLRVPKQWDRFQVNIDEELQQEELSRTLTEREIDDFNRRNLHSVSELSDHLRLLV
FGSDECVTCSEDICAAVEYIVGPQRRWNSSCDEVCEFRRAISRAYLNEWKAFQSVHPSVP
ERLATRSLPQVFSVPPLQKAQMDLLMQMCPRNAETGDGSISMRLWYLDSAGSRCSTRRRF
PFDTAADDAIRLTMSSAREFASMREKTDDTPLIFVFRVKGRNEYIYGSQPLINYRYIRHC
VSKRAEIDLVVEPKEATLFAVPLFRPSYPSRTLASPSDADASKSSTSEICLWDLTSKLSI
RIVGGFEKLAISASRMKDENVRDSSSLYFAVLVEAYVGTWRCCEPQITGWQLCENAKNSH
SLAARVYWKDGGTVTFSIDLSNVPRELKLCFTLVASSTDRIVGARAATAEEVIAAVEENT
KKTDDQGHSVFFLGTAATQLFDYAAKMRMGMWRIYLWEGKTRANPIGLNSINPDSNACTF
EVEFPCFDKPVFFPSGRPPKRKEEDARRNFADREAALSSYLINNEVEQLRQLKRVLMYDP
LVHLSSDDKTILWKYREMLLGQPKAMAKVMSAVNWLMPFDVYEAHCLLRRWSPLAAFDAL
ELLDAHYADLAVREQAVEYIDKMSDYELRGCILQLVQVLKYEPYHYSALARFLLRRSLRS
NHIIGHYVFWYLAAEVKNLTICERHGLLLEELIKRSPHRLDYVRQVYVCNELLKCALRVQ
RAPKKDRVKCLRASLAKVRFPHRFTLALNPSVECCAVDIDECKVMESKKFPLWLAFRNHL
DQDEHFFIIFKSGDDLRQDLLTLQLLEFMDSLWKASGLDLHLIPYGCISTGEGVGMIEVV
LNSDTIANITRREGGAQAAFNVDPIINWLRQFNHDRGEAERCLWNFVLSVAGYTVATYVL
GIGDRHNDNIMLRQDGTLFHIDFGHFLGNFKTKFGIKRETAPFIFTPMYLYAMGGSSSPI
FKYFVDVACRAYNALRRHSSALMMLFMLMLSTGIPELQTLEDIEWLRTVLLLNRTDEEAS
EHYKGLINDALGNFRTLLNDYIHIMVH
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttacgcgtacgactacgggtgcccaagcagtgggataggtttcaggtgaacatc
gacgaggaacttcagcaagaagagctctcaaggactctgacagagagggagatcgatgat
ttcaaccgacggaacctccacagcgtctcggagctcagtgatcatttgcgcttgctcgtc
tttgggagtgatgagtgtgttacctgctctgaggatatttgtgcagctgtcgagtatatt
gtgggtccgcagcgcagatggaacagtagctgcgatgaagtttgcgagtttcggcgcgca
atcagcagagcgtacctgaatgaatggaaggcttttcagtctgtccatccatcggtgcca
gagcgcctcgcgacacgcagcctgccgcaggtgttttctgtacctcctcttcaaaaggca
caaatggatcttctgatgcagatgtgcccgaggaatgcggagacgggagatggcagcatt
tcgatgcgtctatggtatttagatagtgcagggtccagatgctctacgaggcgaaggttt
ccattcgacactgccgccgatgacgccatccggctcacgatgagcagcgcacgggagttt
gcaagcatgagggaaaaaactgatgatacgccgctcatctttgtcttccgtgttaagggg
cgaaacgagtacatttacggttcgcagcctctgataaattatcgttacattcgtcactgt
gtgagcaagcgggctgagatagatttggttgtggagcctaaagaagcgacccttttcgca
gtaccactgtttcgcccgtcctacccgtctcggacccttgcaagtccttctgacgcagat
gcgtcgaagtccagtacctctgaaatctgtttgtgggacctgaccagcaagctctctatc
aggattgtcggcggttttgaaaagcttgccatctccgcgtcgcgcatgaaggatgaaaac
gtgcgcgactcttcgagcctgtactttgcagttcttgtggaggcgtatgttggcacctgg
cgttgctgcgaaccccaaatcactggctggcagctgtgcgagaatgcaaagaacagccac
agcttagctgcaagagtgtactggaaggacgggggaacggtgaccttcagcatcgatctg
tcgaatgtgccaagagagctaaagctgtgttttacgctggtggcttcctcgaccgacaga
atcgtcggtgctcgggcagccactgcagaggaggtgattgccgctgtggaagagaacacg
aagaaaaccgacgatcagggtcactcggtttttttcttgggtacggccgccacgcagctt
ttcgattacgctgcaaaaatgcggatgggtatgtggcgcatctatctatgggagggcaag
acccgcgcgaacccgattggcttgaactctatcaaccccgattccaacgcgtgcacgttc
gaggtggagttcccgtgtttcgacaagcctgtttttttccccagtggtcgacctccaaag
agaaaagaggaggatgctcgacgaaactttgctgaccgtgaggccgccctgagcagctat
ctgatcaacaacgaagtagaacaactgcgccagctgaagcgggtgctgatgtacgatccc
ctggtgcacctctcgagtgacgacaagactattctgtggaagtacagggagatgctccta
ggccaaccaaaggcaatggccaaggtgatgagtgcggtgaactggctgatgccgttcgat
gtgtacgaggcacactgccttttgcgccgatggtccccgctggctgcgttcgatgcgctg
gagctgcttgacgcgcattatgctgacttggcggttcgtgagcaggcggtggagtacatt
gataaaatgtcggactatgagctgcgcggttgtattctgcaactcgtgcaggtactcaag
tacgagccgtatcactactctgccttggcgcgttttctccttaggcggtcgcttcgctcg
aaccacataattggccactacgttttttggtatctagctgccgaagtcaagaatctgacc
atttgcgagcgacacggactccttttggaggaactgatcaagcgatctccgcaccggttg
gactacgtgcggcaagtgtacgtttgcaacgagctgctgaagtgtgcactgagggtgcaa
cgggcgccgaagaaagatcgtgtcaagtgtctgcgcgcgagtctcgctaaggtgcgattt
cctcaccgctttactctcgctctgaacccctcagtggagtgctgcgcggtcgatatcgat
gagtgcaaggtcatggagtcgaagaagttcccgctatggcttgcttttcgaaatcatctc
gatcaagacgagcactttttcatcatattcaagtctggcgacgacctcaggcaagacctg
cttactctgcagctgctggagttcatggacagcctgtggaaagcgtccggtctggacctt
cacctcatcccatacggttgcatctctaccggagaaggcgttggcatgatcgaagtggtg
ttgaacagtgacacgatcgccaacatcacgagacgcgagggtggggcacaggctgcgttc
aacgttgacccgatcataaattggttacgtcagttcaaccatgaccgaggtgaagcggag
cggtgtctgtggaatttcgtgcttagtgtcgccggctacacggtggccacctacgtcctg
ggcatcggtgacagacataatgataacatcatgctccgccaggatggcaccctctttcac
atcgattttggccactttctgggcaacttcaagacgaagttcggcatcaagcgtgagaca
gcgcctttcatttttactcccatgtacctgtatgcgatgggtgggtcaagtagcccgatc
tttaagtactttgtggacgtagcatgccgagcgtacaacgcgctgcggcggcacagcagc
gcacttatgatgctctttatgctgatgctctctacgggcataccggagctacaaaccctg
gaagatatcgagtggctgcgcacagtacttcttcttaaccgaaccgatgaggaagcctcc
gagcactacaaaggcctcatcaacgacgcactgggcaattttcgcacactgctgaacgac
tacatccatattatggtgcactga

DBGET integrated database retrieval system